UniGene Name: sp_v3.0_unigene206222
Length: 237 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene206222
T |
Ace file of the UniGene sp_v3.0_unigene206222
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Cytosolic glyceraldehyde-3-phosophodehydrogenase (Fragment) n=5 Tax=Aquilegia RepID=Q38J04_AQUFO | - | - | 7.0e-16 | 88% |
| FL-Next | sp=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic; Pinus sylvestris (Scots pine). | - | - | 0.0 | 95% |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). | EC:1.2.1.12 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G13440; At1g13440; At1g16300; At1g79530; At1g79530/T8K14_5; At3g04120; F3O9.10; G3PDH; GAPC; GAPC1; GAPC2; GAPC3; GAPD1; GAPD4; GAPDH; GAPDH2; GAPDH_1; GPC; GPC1; GPC2; GPC3; GPDA; GSVIVT00002074001; GSVIVT00020570001; GSVIVT00032009001; GSVIVT00035097 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | phosphopyruvate hydratase complex | GO:0000015 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial envelope | GO:0005740 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | acyl carrier activity | GO:0000036 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
| Sma3 | phosphoglycerate kinase activity | GO:0004618 | Molecular Function | 0.0 | - |
| Sma3 | phosphopyruvate hydratase activity | GO:0004634 | Molecular Function | 0.0 | - |
| Sma3 | triose-phosphate isomerase activity | GO:0004807 | Molecular Function | 0.0 | - |
| Sma3 | transferase activity | GO:0016740 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating) activity | GO:0043891 | Molecular Function | 0.0 | - |
| Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity | GO:0047100 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | IPR000173 | - | 0.0 | - | |
| Sma3 | Triosephosphate isomerase | IPR000652 | - | 0.0 | - |
| Sma3 | Enolase | IPR000941 | - | 0.0 | - |
| Sma3 | Phosphoglycerate kinase | IPR001576 | - | 0.0 | - |
| Sma3 | Thiolase | IPR002155 | - | 0.0 | - |
| Sma3 | Phosphoadenosine phosphosulphate reductase | IPR002500 | - | 0.0 | - |
| Sma3 | Phosphopantetheine-binding | IPR006163 | - | 0.0 | - |
| Sma3 | Glyceraldehyde-3-phosphate dehydrogenase, type I | IPR006424 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Sma3 | Phosphoglycerate kinase, N-terminal | IPR015824 | - | 0.0 | - |
| Sma3 | Phosphoglycerate kinase, conserved site | IPR015911 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G04120.1 | GAPC, GAPC-1, GAPC1 glyceraldehyde-3-phosphate dehydrogenase C subunit 1 chr3:1081077-1083131 FORWARD LENGTH=338 | 7.0e-19 | 87% |
| RefSeq | Arabidopsis thaliana | NP_001077530.1 | glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana] | 7.0e-19 | 87% |
| RefSeq | Populus trichocarpa | XP_002315632.1 | predicted protein [Populus trichocarpa] | 2.0e-21 | 88% |
Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: P34924
Fln msg: your sequence is shorter than subject: 45 - 340
Fln protein:
S
Protein Length:
46
Fln nts:
T
Fln Alignment:
AllPine_b_rep_c63884___SSIFDAQAGIALNDNFVKLVSWFDNEWGYSSRVVDLIVHMAATQ
P34924________________SSIFDAQAGIALSDNFVKLVSWYDNEWGYSSRVVDLIVHMAATQ

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta