UniGene Name: sp_v3.0_unigene206076
Length: 230 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene206076
C |
Ace file of the UniGene sp_v3.0_unigene206076 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | DUF659 domain containing protein | - | - | 7.0e-20 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 71% |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00000858001; GSVIVT00001531001; GSVIVT00002235001; GSVIVT00002367001; GSVIVT00003156001; GSVIVT00006112001; GSVIVT00013610001; GSVIVT00014165001; GSVIVT00022003001; GSVIVT00022661001; GSVIVT00024230001; GSVIVT00029236001; GSVIVT00029960001; GSVIVT00 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | ubiquitin thiolesterase activity | GO:0004221 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | ubiquitin-dependent protein catabolic process | GO:0006511 | Biological Process | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pumilio RNA-binding repeat | IPR001313 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 1 | IPR001360 | - | 0.0 | - |
| Sma3 | Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1 | IPR001578 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | Zinc finger, BED-type predicted | IPR003656 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Domain of unknown function DUF659 | IPR007021 | - | 0.0 | - |
| Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
| Sma3 | HAT dimerisation | IPR008906 | - | 0.0 | - |
| Sma3 | IPR011523 | - | 0.0 | - | |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | IPR015706 | - | 0.0 | - | |
| Sma3 | Zinc finger, C2H2-like | IPR015880 | - | 0.0 | - |
| Sma3 | ABC transporter, integral membrane type 1 | IPR017940 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G36095.1 | DNA binding chr1:13491370-13492725 REVERSE LENGTH=301 | 4.0e-11 | 57% |
| RefSeq | Arabidopsis thaliana | NP_174842.1 | DNA binding protein [Arabidopsis thaliana] | 5.0e-11 | 57% |
| RefSeq | Populus trichocarpa | XP_002329897.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-13 | 59% |
Full-Lengther Next Prediction |
|---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: A5BLW8
Fln msg: Unexpected stop codon in the beginning of your sequence, STOP codon was not found. Distance to subject end: 8 aas, your sequence is shorter than subject: 76 - 254
Fln protein:
P
Protein Length:
77
Fln nts:
C
Fln Alignment:
AllPine_b_c63541___IITDNASNYVLVGKMLEEKHKTIFWTPCAAHCIDLMLEDIGK
A5BLW8________________VITDNASNYVNAGMRLMERRRRLWWTPCAAHCIDLMLEDIGK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)