UniGene Name: sp_v3.0_unigene205645
Length: 206 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene205645
A |
Ace file of the UniGene sp_v3.0_unigene205645
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 8.0e-17 | 64% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 51% |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00019821001; LOC_Os11g05840; LOC_Os11g17390; LOC_Os12g31920; LOC_Os12g34770; OJ1008_D08.2; OSIGBa0127D24.3; OSIGBa0146N20.7; OSJNAb0023M11.2; OSJNBa0033G05.13; OSJNBa0079H23.15; OSJNBb0016G07.9; OSJNBb0023M11.16; Os01g0116100; Os02g0309000; Os02g045 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | exonuclease activity | GO:0004527 | Molecular Function | 0.0 | - |
| Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
| Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | nutrient reservoir activity | GO:0045735 | Molecular Function | 0.0 | - |
| Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | Ionotropic glutamate receptor | IPR001320 | - | 0.0 | - |
| Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
| Sma3 | F-box domain, cyclin-like | IPR001810 | - | 0.0 | - |
| Sma3 | Pleckstrin homology domain | IPR001849 | - | 0.0 | - |
| Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
| Sma3 | Germin | IPR001929 | - | 0.0 | - |
| Sma3 | Putative 5-3 exonuclease | IPR004859 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF295 | IPR005174 | - | 0.0 | - |
| Sma3 | Cupin 1 | IPR006045 | - | 0.0 | - |
| Sma3 | IPR013084 | - | 0.0 | - | |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | RmlC-like jelly roll fold | IPR014710 | - | 0.0 | - |
| Sma3 | F-box associated interaction domain | IPR017451 | - | 0.0 | - |
| Sma3 | Germin, manganese binding site | IPR019780 | - | 0.0 | - |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKX7
Fln msg: Distance to subject end: 114 aas, your sequence is shorter than subject: 68 - 407
Fln protein:
K
Protein Length:
69
Fln nts:
A
Fln Alignment:
AllPine_b_rep_c60555___TIPRTP*ENGVSEMMNRTIMERARCM*LHAR-LPLQFWADAVDTAVYLINRGPSSSLDGGVLKEAW
B8LKX7________________TVPYTPQQNGVAERKNRTLMEMARCM-LHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAW

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta