SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene205044

Length: 501 nt

UniGene Fasta

>sp_v3.0_unigene205044
AATTTTGTTCTTCTGCTTTCTCCAACTTCTGTGATACCCATGGCATCAAACGCCAATTAACTACACCCTACACTCCTCAGCAAAACAGTTTTGTCGAACGTCACAACCGTACGGTTGTTGAAATGGCTTGTTCCATGTTACAACACAGGGGTGTTCCGAACAAATTTTGGGCTAAAGCAGTGTTTACCGTTGTCTATCTTCTTAACCGATCACCTACTCAAGCTGTTAAGGGGAAGACTCCAGAAGAGGTTTGGTCTGGTCGTAAACCTAAGATCAGTCACCTCAAAGTGTTTGGCTCAGTTGCATATGTTTGGATTCCAACTGCTAAGCGCTCTAAGTTGTATTCCAAAAGCCAGAAACTCATGATGACAGTGTACAGTGATCACCACAAGGCCTATAGGCTGATAGATATAGACACTGATCGTCTTATCTTCAGTCGAAACGTAGTATTTAATGAAGACAGAGGGTTCTTTCAGTCTACTCCTTCTGACCAGTGTTCTG

Ace file of the UniGene sp_v3.0_unigene205044

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	T26F17.17 n=1 Tax=Arabidopsis thaliana RepID=Q9SFE1_ARATH	-	-	3.9937e-43	53%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	51%
Sma3	Copia-type polyprotein	-	-	2.159e-10	-

Source	Gene names
Sma3	117M18_33; At2g15650; At2g17490; B1110B01.4; F11I4_21; F28G4.2; GSVIVT00019821001; H0512B01.8; LOC_Os03g05850; LOC_Os03g26290; LOC_Os03g47410; LOC_Os03g47702; LOC_Os03g61660; LOC_Os10g01750; LOC_Os10g04074; LOC_Os10g17570; LOC_Os10g29420; LOC_Os10g41610;

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	tRNA dihydrouridine synthase activity	GO:0017150	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	rRNA N-glycosylase activity	GO:0030598	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	tRNA processing	GO:0008033	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	negative regulation of translation	GO:0017148	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	BTB/POZ-like	IPR000210	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	tRNA-dihydrouridine synthase	IPR001269	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Tetratricopeptide TPR-1	IPR001440	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	Ankyrin repeat	IPR002110	-	-
Sma3	Phosphotransferase system, HPr serine phosphorylation site	IPR002114	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Glucose/ribitol dehydrogenase	IPR002347	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Stem cell self-renewal protein Piwi	IPR003165	-	-
Sma3	HhH-GPD domain	IPR003265	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	Protein of unknown function DUF295	IPR005174	-	-
Sma3		IPR010256	-	-
Sma3	BTB/POZ fold	IPR011333	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Tetratricopeptide repeat-containing domain	IPR013026	-	-
Sma3	BTB/POZ	IPR013069	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Aldolase-type TIM barrel	IPR013785	-	-
Sma3	Domain of unknown function DUF1785	IPR014811	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	Superoxide dismutase, copper/zinc, binding site	IPR018152	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	tRNA-dihydrouridine synthase, conserved site	IPR018517	-	-
Sma3	Tetratricopeptide repeat	IPR019734	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Distance to subject end: 34 aas, your sequence is shorter than subject: 166 - 407

Fln protein: FCSSAFSNFCDTHGIKRQLTTPYTPQQNSFVERHNRTVVEMACSMLQHRGVPNKFWAKAVFTVVYLLNRSPTQAVKGKTPEEVWSGRKPKISHLKVFGSVAYVWIPTAKRSKLYSKSQKLMMTVYSDHHKAYRLIDIDTDRLIFSRNVVFNEDRGFFQSTPSDQCS

Protein Length: 167

Fln nts: AATTTTGTTCTTCTGCTTTCTCCAACTTCTGTGATACCCATGGCATCAAACGCCAATTAACTACACCCTACACTCCTCAGCAAAACAGTTTTGTCGAACGTCACAACCGTACGGTTGTTGAAATGGCTTGTTCCATGTTACAACACAGGGGTGTTCCGAACAAATTTTGGGCTAAAGCAGTGTTTACCGTTGTCTATCTTCTTAACCGATCACCTACTCAAGCTGTTAAGGGGAAGACTCCAGAAGAGGTTTGGTCTGGTCGTAAACCTAAGATCAGTCACCTCAAAGTGTTTGGCTCAGTTGCATATGTTTGGATTCCAACTGCTAAGCGCTCTAAGTTGTATTCCAAAAGCCAGAAACTCATGATGACAGTGTACAGTGATCACCACAAGGCCTATAGGCTGATAGATATAGACACTGATCGTCTTATCTTCAGTCGAAACGTAGTATTTAATGAAGACAGAGGGTTCTTTCAGTCTACTCCTTCTGACCAGTGTTCTG

Fln Alignment:

AllPine_b_rep_c59572___FCSSAFSNFCDTHGIKRQLTTPYTPQQNSFVERHNRTVVEMACSMLQHRGVPNKFWAKAVFTVVYLLNRSPTQAVKGKTPEEVWSGRKPKISHLKVFGSVAYVWIPTAKRSKLYSKSQKLMMTVYSDHHKAYRLIDIDTDRLIFSRNVVFNE
B8LKX7________________YVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAWSRRKPTVSHFKVFGCDVYVHIPDEKRKKLDRKSHKCIMVGYSETSKAYRVYDPEKNEILIRRDVIFDE

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain