SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene204854

Length: 282 nt

UniGene Fasta

>sp_v3.0_unigene204854
ACACTTCACTGAGAATAGCAAGGTGAGATCTGATCTCATGGAGATTTCTTCTTCGCACAACGTCCACATCTCCCATGGGATGAAGAAGAGCAGAAGGCTCAGCACAGAACAAGCAAGGGCATTGGAGAAGAGCTTTGAGTCAGGCAAAATACTGGAAGCCGAGAGGAAAAAAGAGCTGGCAACGGCTCTGGGACTGCACCCAAGGCAAATCGCCATTTGGTTCCAGAACAGAAGAGCCAGATGGAAAACTGCGCAGATAGAGAAAGACTTTGGCGTTCTCAA

Ace file of the UniGene sp_v3.0_unigene204854

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Homeobox-leucine zipper protein HOX23 n=3 Tax=Oryza sativa RepID=HOX23_ORYSJ	-	-	3.0e-20	72%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	68%
Sma3	Homeobox protein, putative	-	-	2.154e-18	-

Source	Gene names
Sma3	ATHB-1; ATHB-13; ATHB-16; ATHB-20; ATHB-21; ATHB-23; ATHB-3; ATHB-5; ATHB-54; ATHB-6; At1g26960; At1g27050; At1g69780; At2g18550; At2g22430; At3g01220; At3g01470; At4g40060; At5g15150; At5g65310; CPHB-4; CPHB-5; CPHB-6; CPHB-7; Crhb11; Crhb6; Crhb8; F14M1

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	protein homodimerization activity	GO:0042803	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	response to water deprivation	GO:0009414	Biological Process	-
Sma3	response to blue light	GO:0009637	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	abscisic acid mediated signaling pathway	GO:0009738	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	response to sucrose stimulus	GO:0009744	Biological Process	-
Sma3	negative regulation of abscisic acid mediated signaling pathway	GO:0009788	Biological Process	-
Sma3	leaf morphogenesis	GO:0009965	Biological Process	-
Sma3	negative regulation of cell growth	GO:0030308	Biological Process	-
Sma3		GO:0045941	Biological Process	-
Sma3	regulation of timing of transition from vegetative to reproductive phase	GO:0048510	Biological Process	-
Sma3	photoperiodism, flowering	GO:0048573	Biological Process	-
Sma3	cotyledon morphogenesis	GO:0048826	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Helix-turn-helix motif	IPR000047	-	-
Sma3	RNA recognition motif domain	IPR000504	-	-
Sma3	Homeodomain	IPR001356	-	-
Sma3	Leucine zipper, homeobox-associated	IPR003106	-	-
Sma3		IPR012287	-	-
Sma3	Nucleotide-binding, alpha-beta plait	IPR012677	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-
Sma3	Small acid-soluble spore protein, alpha/beta-type, conserved site	IPR018126	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G15150.1	ATHB-3, HAT7, ATHB3, HB-3 homeobox 3 chr5:4913951-4915609 REVERSE LENGTH=314	7.0e-25	64%
RefSeq	Arabidopsis thaliana	NP_568309.2	homeobox-leucine zipper protein HAT7 [Arabidopsis thaliana]	1.0e-24	64%
RefSeq	Populus trichocarpa	XP_002306291.1	predicted protein, partial [Populus trichocarpa]	3.0e-25	63%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NVV8

Fln msg: Distance to subject end: 49 aas, your sequence is shorter than subject: 93 - 201

Fln protein: HFTENSKVRSDLMEISSSHNVHISHGMKKSRRLSTEQARALEKSFESGKILEAERKKELATALGLHPRQIAIWFQNRRARWKTAQIEKDFGVL

Protein Length: 94

Fln nts: ACACTTCACTGAGAATAGCAAGGTGAGATCTGATCTCATGGAGATTTCTTCTTCGCACAACGTCCACATCTCCCATGGGATGAAGAAGAGCAGAAGGCTCAGCACAGAACAAGCAAGGGCATTGGAGAAGAGCTTTGAGTCAGGCAAAATACTGGAAGCCGAGAGGAAAAAAGAGCTGGCAACGGCTCTGGGACTGCACCCAAGGCAAATCGCCATTTGGTTCCAGAACAGAAGAGCCAGATGGAAAACTGCGCAGATAGAGAAAGACTTTGGCGTTCTCAA

Fln Alignment:

AllPine_b_rep_c59283___HGMKKSRRLSTEQARALEKSFESGKILEAERKKELATALGLHPRQIAIWFQNRRARWKTAQIEKDFGVL
A9NVV8________________HLGEKKRRLTLEQVRALEKNFEIANKLEPEKKMQLAKALGLQPRQIAVWFQNRRARWKTKQLEKDFNVL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain