|
||||||
|
UniGene Name: sp_v3.0_unigene204608
Length: 214 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene204608
A |
|
Ace file of the UniGene sp_v3.0_unigene204608
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phenylcoumaran benzylic ether reductase homolog TH6 n=4 Tax=Pinaceae RepID=Q9M523_TSUHE | - | - | 9.0e-29 | 88% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | Isoflavone reductase | - | - | 7.772e-22 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidoreductases, Acting on the CH-CH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.3.1.- | - | 9.515e-12 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid biosynthesis | 00061 | 9.515e-12 | % | |
| Sma3 | Phenylalanine metabolism | 00360 | 9.515e-12 | % | |
| Sma3 | Chlorocyclohexane and chlorobenzene degradation | 00361 | 9.515e-12 | % | |
| Sma3 | Fluorobenzoate degradation | 00364 | 9.515e-12 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 9.515e-12 | % | |
| Sma3 | Xylene degradation | 00622 | 9.515e-12 | % | |
| Sma3 | Toluene degradation | 00623 | 9.515e-12 | % | |
| Sma3 | Polycyclic aromatic hydrocarbon degradation | 00624 | 9.515e-12 | % | |
| Sma3 | Propanoate metabolism | 00640 | 9.515e-12 | % | |
| Sma3 | Isoflavonoid biosynthesis | 00943 | 9.515e-12 | % | |
| Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 9.515e-12 | % | |
| Sma3 | Metabolic pathways | 01100 | 9.515e-12 | % | |
| Sma3 | 2'-hydroxyisoflavone reductase. | EC:1.3.1.45 | - | 1.635e-26 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isoflavonoid biosynthesis | 00943 | 1.635e-26 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.635e-26 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.635e-26 | % |
| Source | Gene names |
|---|---|
| Sma3 | A622; A622L; AT4g34540; AT4g39230; At1g75280; At1g75290; At1g75300; At1g75300/F22H5_16; At4g34540; At4g39230; BETV6; BETV6.0102; DDCBER1; F22H5.16; F22H5.17; F22H5.18; GSVIVT00014594001; GSVIVT00017628001; GSVIVT00023330001; GSVIVT00036356001; GSVIVT00036 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
| Sma3 | leucoanthocyanidin reductase activity | GO:0033788 | Molecular Function | 0.0 | - |
| Sma3 | 2'-hydroxyisoflavone reductase activity | GO:0047526 | Molecular Function | 0.0 | - |
| Sma3 | regulation of nitrogen utilization | GO:0006808 | Biological Process | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cecropin | IPR000875 | - | 0.0 | - |
| Sma3 | NmrA-like | IPR008030 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Peptidase S26A, signal peptidase I, conserved site | IPR019758 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G39230.1 | NmrA-like negative transcriptional regulator family protein chr4:18266024-18267604 REVERSE LENGTH=308 | 5.0e-31 | 72% |
| RefSeq | Arabidopsis thaliana | NP_195634.1 | NmrA-like negative transcriptional regulator family protein [Arabidopsis thaliana] | 7.0e-31 | 72% |
| RefSeq | Populus trichocarpa | XP_002313788.1 | phenylcoumaran benzylic ether reductase 3 [Populus trichocarpa] | 2.0e-30 | 73% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUA2
Fln msg: Distance to subject end: 62 aas, your sequence is shorter than subject: 70 - 307
Fln protein:
K
Protein Length:
71
Fln nts:
A
Fln Alignment:
AllPine_b_c58911___KIVIAGDGNARAVFVKEEDIGTFTIKAVDDPRTLNKILYLRLPANTYSINELVALWEKKIGKTLEKTYI
A9NUA2________________KAVINGDGNAKVVFVKEEDIGTFTIKAVDDPRTLNKILYLRLPANTYSINELVALWEKKIGKTLEKTYI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
