|
||||||
|
UniGene Name: sp_v3.0_unigene204065
Length: 208 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene204065
T |
|
Ace file of the UniGene sp_v3.0_unigene204065
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Peptidyl-prolyl cis-trans isomerase n=1 Tax=Camellia oleifera RepID=B6VEG9_9ERIC | - | - | 8.0e-13 | 78% |
| FL-Next | sp=Peptidyl-prolyl cis-trans isomerase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Peptidyl-prolyl cis-trans isomerase | - | - | 1.26117e-44 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidylprolyl isomerase. | EC:5.2.1.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 56B23-g9; At2g29960; At3g55920; At5g58710; CYP19-4; CYP20-1; CYP21-2; CYP23-a; CYP23-b; CYP23-c; CYP5; Cyp2; F23F1.12; F27K19_100; GSVIVT00024100001; GSVIVT00029291001; MICPUCDRAFT_30855; MICPUN_97666; MZN1.15; Os06g0708500; OsI_24414; OsJ_22614; P0621D05 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | membrane fraction | GO:0005624 | Cellular Component | 0.0 | - |
| Sma3 | multivesicular body | GO:0005771 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
| Sma3 | Golgi stack | GO:0005795 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | peptide binding | GO:0042277 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain | IPR002130 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G29960.1 | CYP5, ATCYP5, CYP19-4 cyclophilin 5 chr2:12769183-12770528 REVERSE LENGTH=201 | 3.0e-15 | 88% |
| RefSeq | Arabidopsis thaliana | NP_001077978.1 | Peptidyl-prolyl cis-trans isomerase CYP19-4 [Arabidopsis thaliana] | 3.0e-15 | 88% |
| RefSeq | Populus trichocarpa | XP_002298312.1 | isomerase peptidyl-prolyl cis-trans isomerase [Populus trichocarpa] | 3.0e-15 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NK21
Fln msg: Distance to subject end: 132 aas, atg_distance in limit (1-15): atg_distance = 4, W2: There is no M at the beginning, your sequence is shorter than subject: 69 - 204
Fln protein:
Y
Protein Length:
70
Fln nts:
T
Fln Alignment:
AllPine_b_rep_c58036___KAKHEDLEEVTHKVYFDVDIAGKPAGRVVIGLFGKAVPKT
A9NK21________________QAKNENPEEITHKVYFDVEIAGKPAGRVVIGLFGKTVPKT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
