SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene203659

Length: 394 nt

UniGene Fasta

>sp_v3.0_unigene203659
ATTTATTGTATTAAGAATAAATCTGATGTATTTGATACTTTCAAGAAATGGAAAGCTTTGGTTGAGATTGAGACAGGAAAGAAATTGAAGTGTCTTAGATCAGACAATGGAGGTGAATATTGCAGCAAAGAGTTTGATAGGTACTGTTCAGAGCATGGAATTCGCAGAGAGAAGACAGTTCTAAGAACACCACAAGAAAATGGTGTGTCAGAAAGGATGAACAGAACAATCATGGAGCGTGCAAGGTGTATGAGATTGCATGCAGGATTGCCTTCACAGTTTTGGGCAGATGCTGTAGATACTGCTGTTTATCTAATAAACAGAGGACCTTCAAGTTCCTTGGATGGTGGTGTTCCAGAGGAAGCATGGACAGGTAAAAAGGCAAACTACTCTA

Ace file of the UniGene sp_v3.0_unigene203659

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	rve domain containing protein	-	-	9.0e-20	41%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	51%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	2.913e-16	-

Source	Gene names
Sma3	AT4g03810; AT4g04380; AT4g10460; AT4g21360; At2g05960; At2g07550; At2g13930; At2g15700; At2g17490; At2g19840; At2g21460; B1110B01.4; F11I4_21; F28L22.3; F7L13.40; F9K21.100; GSVIVT00006382001; GSVIVT00019821001; H0306F03.15; H0413E07.4; LOC_Os03g26290; LO

Source	GOs	Term	Type	Identity
Sma3	phosphopyruvate hydratase complex	GO:0000015	Cellular Component	-
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	apoplast	GO:0048046	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	dihydrofolate reductase activity	GO:0004146	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	exonuclease activity	GO:0004527	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	phosphopyruvate hydratase activity	GO:0004634	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	ionotropic glutamate receptor activity	GO:0004970	Molecular Function	-
Sma3	extracellular-glutamate-gated ion channel activity	GO:0005234	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	manganese ion binding	GO:0030145	Molecular Function	-
Sma3	nutrient reservoir activity	GO:0045735	Molecular Function	-
Sma3	NADP binding	GO:0050661	Molecular Function	-
Sma3	glycolysis	GO:0006096	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	glycine biosynthetic process	GO:0006545	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	nucleotide biosynthetic process	GO:0009165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Enolase	IPR000941	-	-
Sma3	CCAAT-binding transcription factor, subunit B	IPR001289	-	-
Sma3	Ionotropic glutamate receptor	IPR001320	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Dihydrofolate reductase domain	IPR001796	-	-
Sma3	F-box domain, cyclin-like	IPR001810	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Germin	IPR001929	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Putative 5-3 exonuclease	IPR004859	-	-
Sma3	Protein of unknown function DUF295	IPR005174	-	-
Sma3	Cupin 1	IPR006045	-	-
Sma3	Zinc finger, PMZ-type	IPR006564	-	-
Sma3	Zinc finger, SWIM-type	IPR007527	-	-
Sma3		IPR010256	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3	Dihydrofolate reductase	IPR012259	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	RmlC-like jelly roll fold	IPR014710	-	-
Sma3	Acyl-CoA N-acyltransferase	IPR016181	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	F-box associated interaction domain	IPR017451	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	Germin, manganese binding site	IPR019780	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	ATMG00710.1	ORF120 Polynucleotidyl transferase, ribonuclease H-like superfamily protein chrM:207553-207915 REVERSE LENGTH=120	4.0e-12	47%
RefSeq	Arabidopsis thaliana	NP_085530.1	hypothetical protein ArthMp063 (mitochondrion) [Arabidopsis thaliana]	5.0e-12	47%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Distance to subject end: 108 aas, your sequence is shorter than subject: 131 - 407

Fln protein: IYCIKNKSDVFDTFKKWKALVEIETGKKLKCLRSDNGGEYCSKEFDRYCSEHGIRREKTVLRTPQENGVSERMNRTIMERARCMRLHAGLPSQFWADAVDTAVYLINRGPSSSLDGGVPEEAWTGKKANYS

Protein Length: 132

Fln nts: ATTTATTGTATTAAGAATAAATCTGATGTATTTGATACTTTCAAGAAATGGAAAGCTTTGGTTGAGATTGAGACAGGAAAGAAATTGAAGTGTCTTAGATCAGACAATGGAGGTGAATATTGCAGCAAAGAGTTTGATAGGTACTGTTCAGAGCATGGAATTCGCAGAGAGAAGACAGTTCTAAGAACACCACAAGAAAATGGTGTGTCAGAAAGGATGAACAGAACAATCATGGAGCGTGCAAGGTGTATGAGATTGCATGCAGGATTGCCTTCACAGTTTTGGGCAGATGCTGTAGATACTGCTGTTTATCTAATAAACAGAGGACCTTCAAGTTCCTTGGATGGTGGTGTTCCAGAGGAAGCATGGACAGGTAAAAAGGCAAACTACTCTA

Fln Alignment:

AllPine_b_rep_c57232___IYCIKNKSDVFDTFKKWKALVEIETGKKLKCLRSDNGGEYCSKEFDRYCSEHGIRREKTVLRTPQENGVSERMNRTIMERARCMRLHAGLPSQFWADAVDTAVYLINRGPSSSLDGGVPEEAWTGKKANYS
B8LKX7________________VYFLKNKDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATYIVNRTPTIAVKHKTPEEAWSRRKPTVS

SNPs (tot: 1)

Position	A %	C %	G %	T %	Probability
275		66		33	0.997456

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain