|
||||||
|
UniGene Name: sp_v3.0_unigene203283
Length: 170 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene203283
C |
|
Ace file of the UniGene sp_v3.0_unigene203283
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Phytochrome n=12 Tax=Pinaceae RepID=PHY_PICAB | - | - | 2.0e-22 | 90% |
| FL-Next | sp=Phytochrome; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 90% |
| Sma3 | Phytochrome | - | - | 4.745e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | PHY1; PHY2; PHY3; PHY4; PHY5a; PHY5b; PHY5c; PHYPADRAFT_115388; PHYPADRAFT_165601; PHYPADRAFT_185248; PHYPADRAFT_208532; PHYPADRAFT_218861; PHYPADRAFT_225644; phy2; phy3; phy4; phyN; psphy; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | G-protein coupled photoreceptor activity | GO:0008020 | Molecular Function | 0.0 | - |
| Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
| Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
| Sma3 | sensory perception | GO:0007600 | Biological Process | 0.0 | - |
| Sma3 | red, far-red light phototransduction | GO:0009585 | Biological Process | 0.0 | - |
| Sma3 | protein-tetrapyrrole linkage | GO:0017006 | Biological Process | 0.0 | - |
| Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
| Sma3 | protein-chromophore linkage | GO:0018298 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | PAS | IPR000014 | - | 0.0 | - |
| Sma3 | PAS-associated, C-terminal | IPR000700 | - | 0.0 | - |
| Sma3 | Phytochrome | IPR001294 | - | 0.0 | - |
| Sma3 | PAC motif | IPR001610 | - | 0.0 | - |
| Sma3 | GAF domain | IPR003018 | - | 0.0 | - |
| Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
| Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
| Sma3 | Phytochrome A/B/C/D/E | IPR012129 | - | 0.0 | - |
| Sma3 | Phytochrome, central region | IPR013515 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore binding site | IPR013516 | - | 0.0 | - |
| Sma3 | PAS fold-2 | IPR013654 | - | 0.0 | - |
| Sma3 | PAS fold | IPR013767 | - | 0.0 | - |
| Sma3 | Phytochrome chromophore attachment domain | IPR016132 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q40762
Fln msg: Distance to subject end: 44 aas, your sequence is shorter than subject: 56 - 1136
Fln protein:
R
Protein Length:
57
Fln nts:
C
Fln Alignment:
AllPine_b_c56332___RFTASEGWVGIKVVPTKRHLGSGVNVMHIEFRITHPGQGIPEELIKEMFVHNQDM
Q40762________________RFSTSEGWVGNKVVPTKRHLGSGVNVMHMEFRITHSGQGIPEELIKEMFVHNQDM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
