|
||||||
|
UniGene Name: sp_v3.0_unigene202819
Length: 187 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene202819
A |
|
Ace file of the UniGene sp_v3.0_unigene202819
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Putative peroxidase (Fragment) n=1 Tax=Pisum sativum RepID=Q5JC57_PEA | - | - | 1.0e-16 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
| Sma3 | Peroxidase | - | - | 2.56e-08 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 8.488e-26 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 8.488e-26 | % | |
| Sma3 | Methane metabolism | 00680 | 8.488e-26 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 8.488e-26 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.488e-26 | % | |
| Sma3 | Metabolic pathways | 01100 | 8.488e-26 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.488e-26 | % |
| Source | Gene names |
|---|---|
| Sma3 | At3g21770; At5g51890; GSVIVT00006924001; GSVIVT00019842001; GSVIVT00022533001; GSVIVT00022535001; GSVIVT00022537001; GSVIVT00026051001; GSVIVT00026052001; GSVIVT00026053001; GSVIVT00037159001; LOC_Os03g02920; LOC_Os10g39170; MJM18.4; MSD21.10; MSD21.8; OJ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G21770.1 | Peroxidase superfamily protein chr3:7673345-7674661 FORWARD LENGTH=329 | 4.0e-17 | 58% |
| RefSeq | Arabidopsis thaliana | NP_188814.1 | peroxidase 30 [Arabidopsis thaliana] | 6.0e-17 | 58% |
| RefSeq | Populus trichocarpa | XP_002317837.1 | predicted protein [Populus trichocarpa] | 1.0e-20 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NMN9
Fln msg: Distance to subject end: 95 aas, your sequence is shorter than subject: 61 - 333
Fln protein:
V
Protein Length:
62
Fln nts:
A
Fln Alignment:
AllPine_b_rep_c54927___VTQLTQSFSAKGLSQEEMVILSGAHTIGVSHCSSFVSRLYNFNATFQTDPSLDPNYANMLK
A9NMN9________________LNQLNFLFASKGLSQTDMVALSGAHTLGFSHCNQISNRIYSFSASTPVDPSLNPSYATQLQ
| SNPs (tot: 5) |
|---|
| Position | A % | C % | G % | T % | Probability |
|---|---|---|---|---|---|
| 71 | 66 | 33 | 0.997464 | ||
| 74 | 66 | 33 | 0.997476 | ||
| 101 | 75 | 25 | 0.99649 | ||
| 160 | 75 | 25 | 0.996476 | ||
| 179 | 25 | 75 | 0.996475 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
