SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene202436

Length: 505 nt

UniGene Fasta

>sp_v3.0_unigene202436
GAAGATCATGGAGTATGCAAGGGATGTGCATTAGGTAAGGACACCAAGAGACCATTTGGAAGCAGTGCTTCAAGGTCAAAAGAAATCTTGGTTCTTATTCATTCCGATGTTTGTGGTCCTATGACTCCTAATTCTCTTGTAGGTCATCTATATTATGTCACATTTATAGATAATCATTCAAGGAAAACTTAGGTTTACTTAATGAAAACCAAGGATGAAGTATTTACAAAATTTCAAGAATTCAAGGCTGAAGTTGAGAACCTTACAGAAAGAAGAATCAAGATACTAAGATTTGATAATGGAGGAGAATATACATCCAAAGAGATTATAGCATTTTGTAAGGAGTCTGGGATTAAGAGGGAGCTGATAGTCCCATACAATCCCAAACAAAATGGAGTTGCAGAACGAAAGAATCAATCCATTGAAGAAAGTGTAAAAGCAATGTTACATGATCCAGATTTACCTAAATTTCTGTGGGGTGAAGCTACGAAGACAGTTGTATACA

Ace file of the UniGene sp_v3.0_unigene202436

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Copia-type polyprotein, putative n=4 Tax=Arabidopsis thaliana RepID=Q9C739_ARATH	-	-	9.99995e-41	52%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	49%
Sma3	Retrotransposon protein, putative, Ty1-copia subclass	-	-	0.0	-

Source	Gene names
Sma3	AT4g04380; AT4g10460; At2g07550; At2g17490; At2g21460; B1110B01.13; B1130H05.2; F11I4_21; F7L13.40; F9K21.100; LOC_Os03g11850; LOC_Os03g21419; LOC_Os03g26290; LOC_Os03g29130; LOC_Os03g31134; LOC_Os03g31200; LOC_Os03g33640; LOC_Os03g35560; LOC_Os03g41000;

Source	GOs	Term	Type	Identity
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	intrinsic to membrane	GO:0031224	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	endonuclease activity	GO:0004519	Molecular Function	-
Sma3	peroxidase activity	GO:0004601	Molecular Function	-
Sma3	transmembrane signaling receptor activity	GO:0004888	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	carbohydrate binding	GO:0030246	Molecular Function	-
Sma3	flavin adenine dinucleotide binding	GO:0050660	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	transposition	GO:0032196	Biological Process	-
Sma3	innate immune response	GO:0045087	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Toll/interleukin-1 receptor homology (TIR) domain	IPR000157	-	-
Sma3	Peptidase, cysteine peptidase active site	IPR000169	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	PAC motif	IPR001610	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Haem peroxidase, plant/fungal/bacterial	IPR002016	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	Short-chain dehydrogenase/reductase SDR	IPR002198	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	FAD linked oxidase, N-terminal	IPR006094	-	-
Sma3	CS-like domain	IPR007052	-	-
Sma3		IPR010256	-	-
Sma3	Rhamnogalacturonate lyase	IPR010325	-	-
Sma3	Leucine-rich repeat 3	IPR011713	-	-
Sma3	Berberine/berberine-like	IPR012951	-	-
Sma3	EGF-like region, conserved site	IPR013032	-	-
Sma3		IPR013084	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	FAD-binding, type 2	IPR016166	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	CS domain	IPR017447	-	-
Sma3	Peptidase A2A, retrovirus RVP subgroup	IPR018061	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LKX7

Fln msg: Distance to subject end: 135 aas, your sequence is shorter than subject: 168 - 407

Fln protein: EDHGVCKGCALGKDTKRPFGSSASRSKEILVLIHSDVCGPMTPNSLVGHLYYVTFIDNHSRKT*VYLMKTKDEVFTKFQEFKAEVENLTERRIKILRFDNGGEYTSKEIIAFCKESGIKRELIVPYNPKQNGVAERKNQSIEESVKAMLHDPDLPKFLWGEATKTVVY

Protein Length: 169

Fln nts: GAAGATCATGGAGTATGCAAGGGATGTGCATTAGGTAAGGACACCAAGAGACCATTTGGAAGCAGTGCTTCAAGGTCAAAAGAAATCTTGGTTCTTATTCATTCCGATGTTTGTGGTCCTATGACTCCTAATTCTCTTGTAGGTCATCTATATTATGTCACATTTATAGATAATCATTCAAGGAAAACTTAGGTTTACTTAATGAAAACCAAGGATGAAGTATTTACAAAATTTCAAGAATTCAAGGCTGAAGTTGAGAACCTTACAGAAAGAAGAATCAAGATACTAAGATTTGATAATGGAGGAGAATATACATCCAAAGAGATTATAGCATTTTGTAAGGAGTCTGGGATTAAGAGGGAGCTGATAGTCCCATACAATCCCAAACAAAATGGAGTTGCAGAACGAAAGAATCAATCCATTGAAGAAAGTGTAAAAGCAATGTTACATGATCCAGATTTACCTAAATTTCTGTGGGGTGAAGCTACGAAGACAGTTGTATACA

Fln Alignment:

AllPine_b_rep_c52516___EDHGVCKGCALGKDTKRPFGSSAS-RSKEILVLIHSDVCGPMTPNSLVGHLYYVTFIDNHSRKT*VYLMKTKDEVFTKFQEFKAEVENLTERRIKILRFDNGGEYTSKEIIAFCKESGIKRELIVPYNPKQNGVAERKNQSIEESVKAMLHDPDLPKFLWGEATKTVVY
B8LKX7________________QSQGVCEGCMSGKQHMEKFIKGKSWRAKTPLHLVHSDLMGPLEHPSISGSRYVLTFIDDYSRRIWVYFLKNKDEVFEKFKEFKAFVEKQSGKSIKILRTDNGKEYVNKEFDHYCKYNGIKREHTVPYTPQQNGVAERKNRTLMEMARCMLHARNMDPKFWAEAINTATY

SNPs (tot: 17)

Position	A %	C %	G %	T %	Probability
293		42		57	1.0
294		14		85	0.993533
322	85		14		0.993533
325	14		57	28	1.0
328		16		83	0.994512
334	83			16	0.994512
337		33		66	1.0
349	40			60	1.0
350	40		60		1.0
355		16		83	0.994512
363	80			20	0.995493
365		80		20	0.995493
373		80		20	0.995496
377		20		80	0.995493
379		60		40	1.0
384		75		25	0.996476
385		75		25	0.996479

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain