SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene201925

Length: 931 nt

UniGene Fasta

Ace file of the UniGene sp_v3.0_unigene201925

Annotations

Source	Descriptions	Term	Type	Identity
AutoFact	Gypsy/Ty-3 retroelement polyprotein; 69905-74404 n=1 Tax=Arabidopsis thaliana RepID=Q9LHM4_ARATH	-	-	59%
FL-Next	tr=Putative uncharacterized protein; Vitis vinifera (Grape).	-	-	61%
Sma3	Pol protein integrase region	-	-	-

Source	Gene names
Sma3	At2g14640; B1234D02.1; F23H6.1; H0207B04.5; H0321H01.8; H0409D10.7; H0425E08.11; H0502G05.10; H0502G05.7; H0512B01.1; H0522A01.6; H0616A11.3; H0820C10.2; LOC_Os03g05340; LOC_Os03g05350; LOC_Os03g09990; LOC_Os03g13350; LOC_Os03g23780; LOC_Os03g26760; LOC_O

Source	GOs	Term	Type	Identity
Sma3	chromatin	GO:0000785	Cellular Component	-
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	ribosome	GO:0005840	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	chromatin binding	GO:0003682	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	structural constituent of ribosome	GO:0003735	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	carbonate dehydratase activity	GO:0004089	Molecular Function	-
Sma3	aspartic-type endopeptidase activity	GO:0004190	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	sugar binding	GO:0005529	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	protein methyltransferase activity	GO:0008276	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	chromatin assembly or disassembly	GO:0006333	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	translation	GO:0006412	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	protein methylation	GO:0006479	Biological Process	-
Sma3	proteolysis	GO:0006508	Biological Process	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	apoptotic process	GO:0006915	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	carbon utilization	GO:0015976	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Ribosomal protein S15	IPR000589	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Chromo domain/shadow	IPR000953	-	-
Sma3	Legume lectin, alpha chain, conserved site	IPR000985	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Carbonic anhydrase	IPR001765	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Protein translocase complex, SecE/Sec61-gamma subunit	IPR001901	-	-
Sma3	Peptidase aspartic, active site	IPR001969	-	-
Sma3	NB-ARC	IPR002182	-	-
Sma3	DNA-binding WRKY	IPR003657	-	-
Sma3	Retrotransposon gag protein	IPR005162	-	-
Sma3	General substrate transporter	IPR005828	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	Protein of unknown function DUF594	IPR007658	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Domain of unknown function DUF834	IPR008552	-	-
Sma3	Peptidase aspartic, catalytic	IPR009007	-	-
Sma3	S15/NS1, RNA-binding	IPR009068	-	-
Sma3	Ribosomal L11 methyltransferase, PrmA	IPR010456	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Retroviral aspartyl protease	IPR013242	-	-
Sma3	Concanavalin A-like lectin/glucanase, subgroup	IPR013320	-	-
Sma3	Zinc finger, H2C2-type, histone UAS binding	IPR015416	-	-
Sma3	Carbonic anhydrase, prokaryotic-like, conserved site	IPR015892	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Peroxidase, active site	IPR019794	-	-

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: A5BEK1

Fln msg: Separated hits, possible frame ERROR between 491 and 670, Distance to subject end: 59 aas, your sequence is shorter than subject: 310 - 1469

Fln protein: IKTSGLLQPLSIPNQRWEEVSMDFITSLPKSEGKSIIMVVVNRLTKYAHFCALSHPFKASTVFTSFMETIQKLHGNPKIIVSDRDPIFTGNFWTELFSCLGTQLAHSSSYHPQSDGQTEIVNKCLEGYLRCFVSDKQTQWVKWLPLAEWWYNTSFHTATKMTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKF*LGDWVFLWLQPYK*MSLKQAKKYSKLSPKYYGTYKVLQKIGTMAYKLELPATSRVHPVFHVSCLKKVIGDKLPVQTIFPELDE

Protein Length: 311

Fln nts: CAATTAAGACATCGGGTCTATTACAACCTTTATCCATTCCAAACCAACGTTGGGAGGAGGTTTCAATGGATTTTATCACAAGTTTACCCAAGTCGGAGGGAAAGAGCATCATCATGGTGGTAGTCAACAGACTTACCAAGTACGCACACTTTTGTGCATTATCTCATCCATTTAAAGCGAGTACCGTTTTTACTTCATTTATGGAAACAATTCAAAAGCTACATGGAAACCCGAAGATTATTGTAAGTGACAGAGATCCCATTTTCACTGGAAATTTTTGGACAGAATTATTTTCTTGTCTTGGTACTCAGTTAGCTCATAGCTCATCTTATCATCCTCAATCTGATGGGCAAACTGAGATAGTAAACAAATGTTTGGAAGGATATCTTCGTTGCTTTGTATCTGATAAACAGACACAATGGGTCAAATGGTTGCCTCTGGCTGAATGGTGGTATAACACTTCCTTCCATACAGCAACAAAAATGACCCCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAAAGAAGTTTTGATTAGGTGATTGGGTATTCCTATGGCTACAACCATATAAATAAATGTCCCTCAAGCAAGCTAAGAAGTATAGTAAATTGTCACCAAAGTATTATGGTACATACAAGGTGTTGCAAAAGATTGGTACTATGGCATACAAATTGGAGCTTCCTGCAACTTCTCGAGTGCACCCAGTTTTCCATGTTTCATGTTTAAAGAAGGTTATAGGCGACAAGCTCCCAGTTCAAACAATATTTCCAGAACTTGATGAGG

Fln Alignment:

AllPine_b_rep_c46105___IKTSGLLQPLSIPNQRWEEVSMDFITSLPKSEGKSIIMVVVNRLTKYAHFCALSHPFKASTVFTSFMETIQKLHGNPKIIVSDRDPIFTGNFWTELFSCLGTQLAHSSSYHPQSDGQTEIVNKCLEGYLRCFVSDKQTQWVKWLPLAEWWYNTSFHTATKMTPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKKF*LGDWVFLWLQPYK*MSLKQAKKYSKLSPKYYGTYKVLQKIGTMAYKLELPATSRVHPVFHVSCLKKVIGDKLPVQTIFPELDE
A5BEK1________________IHPAGLLQPLPIPTKVWTDISLDFIEGLPNSESYSVIMVVVDRLSKYAHFIPISHPYTASKIAQVFLANIFKLHGLPNSIVTDRDPTFTSTFWKELFKLQGTTLKFSSAYHPQTDGQTEIVNKMVEQYLRCFSGDKPKGWVKWLPLAEWWYNTNIHASTKLSPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRSFNIGDLVYLRLQPYKQQSVVQRRNL-KLSPRFYGPYRVLEKIGTVAYRLELPPEAKIHPVFHVSCLKEKLGERHQLVVTLPPXDK

SNPs (tot: 22)

Position	A %	C %	G %	T %	Probability
380	85		14		0.993533
383	85			14	0.993533
400	14			85	0.993533
413	14		85		0.993533
425	14	85			0.993533
430	14		85		0.993533
436		85	14		0.993533
443		14		85	0.993533
473	57			42	1.0
515	33		66		0.997457
553	66			33	0.997453
562		66		33	0.997452
596		33		66	0.997457
599		66		33	0.997471
601	66		33		0.997452
606		33		66	0.997476
621	33		66		0.997453
638	66			33	0.997452
651	33		66		0.997455
664	66		33		0.997452
668	33			66	0.997452
669		33	66		0.997456

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain