UniGene Name: sp_v3.0_unigene201105
Length: 145 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene201105
A |
Ace file of the UniGene sp_v3.0_unigene201105
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Similar to putative receptor protein kinase from A. thaliana n=1 Tax=Hordeum vulgare subsp. vulgare RepID=Q8S407_HORVD | - | - | 2.0e-13 | 72% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | Chromosome undetermined scaffold_302, whole genome shotgun sequence | - | - | 3.107e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 6.768e-14 | - |
| Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.554e-12 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.686e-12 | - |
| Source | Gene names |
|---|---|
| Sma3 | 24K23.9; At1g11280; At1g11280/T28P6.7; At1g61380; At1g61550; At1g70530; At2g20300; At4g04490; At4g04500; At4g04510; At4g21410; At4g23270; At4g38830; B0808H03.3; CM0216.580.nc; CRK19; CRK26; CRK29; CRK3; CRK36; CRK37; CRK38; F21P8.160; F24J13.10; F5A18.8; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | protoderm histogenesis | GO:0010068 | Biological Process | 0.0 | - |
| Sma3 | cuticle development | GO:0042335 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Sma3 | organ formation | GO:0048645 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G70530.1 | CRK3 cysteine-rich RLK (RECEPTOR-like protein kinase) 3 chr1:26588750-26591379 REVERSE LENGTH=646 | 1.0e-16 | 68% |
| RefSeq | Arabidopsis thaliana | NP_177210.1 | cysteine-rich receptor-like protein kinase 3 [Arabidopsis thaliana] | 1.0e-16 | 68% |
| RefSeq | Populus trichocarpa | XP_002308093.1 | predicted protein, partial [Populus trichocarpa] | 5.0e-18 | 72% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLL8
Fln msg: Distance to subject end: 165 aas, your sequence is shorter than subject: 48 - 245
Fln protein:
G
Protein Length:
49
Fln nts:
A
Fln Alignment:
AllPine_b_c44278___GLAYLHEDSNMRIIHRDIKCGNILLDDRFHPKIADFGMARFFTEGDTN
B8LLL8________________GLTYLHEDSNVRIIHRDIKCGNILLDDRFHPKIADFGLARFFPDGETH

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta