UniGene Name: sp_v3.0_unigene198964
Length: 220 nt
UniGene Fasta |
---|
>sp_v3.0_unigene198964
A |
Ace file of the UniGene sp_v3.0_unigene198964 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein kinase domain-containing protein n=1 Tax=Capsaspora owczarzaki ATCC 30864 RepID=E9CBR2_9EUKA | - | - | 2.0e-24 | 69% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
Source | Gene names |
---|---|
Sma3 | At5g23580; CDPK9; CPK12; GSVIVT00001083001; GSVIVT00031812001; LOC_Os03g57450; MQM1.15; OSJNBb0024J04.20; Os03g0788500; OsI_13822; OsJ_12879; PHATRDRAFT_25067; POPTRDRAFT_1102323; POPTRDRAFT_728605; RCOM_1599390; THAPSDRAFT_789; VITISV_030252; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome, centromeric region | GO:0000775 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | phosphorylase kinase complex | GO:0005964 | Cellular Component | 0.0 | - |
Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | phosphorylase kinase activity | GO:0004689 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | glycogen biosynthetic process | GO:0005978 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | meiotic chromosome segregation | GO:0045132 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Calcium-binding EF-hand | IPR002048 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Phosphorylase kinase, gamma catalytic subunit | IPR002291 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Shugoshin, C-terminal | IPR011515 | - | 0.0 | - |
Sma3 | EF-hand-like domain | IPR011992 | - | 0.0 | - |
Sma3 | IPR015734 | - | 0.0 | - | |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | EF-hand | IPR018248 | - | 0.0 | - |
Sma3 | EF-HAND 2 | IPR018249 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G12580.1 | PEPKR1 phosphoenolpyruvate carboxylase-related kinase 1 chr1:4283635-4285675 FORWARD LENGTH=522 | 8.0e-19 | 53% |
RefSeq | Arabidopsis thaliana | NP_172719.1 | phosphoenolpyruvate carboxylase-related kinase 1 [Arabidopsis thaliana] | 1.0e-18 | 53% |
RefSeq | Populus trichocarpa | XP_002319653.1 | predicted protein [Populus trichocarpa] | 1.0e-21 | 49% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LP72
Fln msg: Distance to subject end: 32 aas, your sequence is shorter than subject: 73 - 283
Fln protein:
T
Protein Length:
74
Fln nts:
A
Fln Alignment:
AllPine_b_c41048___TPGYVAPEVLKGEGYHQEVDVWSIGVIMYILLCGFPPFYGANNTQLFEKIMAGTYWFPSPYWDLITPSAKDLI
B8LP72________________TPYYVAPEVLGGKDYSEKVDVWSAGVIVYIMLSGVAPFLGDTPQEIFEAVLCGRLRFPSDPWLSISNSAKDLI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain