UniGene Name: sp_v3.0_unigene198641
Length: 197 nt
![]() |
---|
>sp_v3.0_unigene198641
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | - | - | 1.0e-07 | 26% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Sma3 | Similarity to AAA-type ATPase | - | - | 2.926e-23 | - |
Source | Gene names |
---|---|
Sma3 | AT4g30250; At2g18190; At2g18193; At2g46620; At3g28510; At3g28540; At3g28580; At3g28600; At3g50930; At3g50940/F18B3_220; At4g25835; At4g30250; At5g17730; At5g17740; At5g17760; At5g40010; At5g57480; F18B3.210; F18B3.220; F9N11.100; GSVIVT00000059001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plastid | GO:0009536 | Cellular Component | 0.0 | - |
Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Carbonic anhydrase | IPR001765 | - | 0.0 | - |
Sma3 | IPR001984 | - | 0.0 | - | |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
Sma3 | Phospholipase-like, arabidopsis | IPR007942 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Carbonic anhydrase, prokaryotic-like, conserved site | IPR015892 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G30250.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr4:14811262-14812821 REVERSE LENGTH=519 | 1.0e-22 | 83% |
RefSeq | Arabidopsis thaliana | NP_194754.2 | AAA domain-containing protein [Arabidopsis thaliana] | 1.0e-22 | 83% |
RefSeq | Populus trichocarpa | XP_002325059.1 | predicted protein, partial [Populus trichocarpa] | 6.0e-23 | 83% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LKR9
Fln msg: Distance to subject end: 242 aas, your sequence is shorter than subject: 65 - 550
Fln protein:
P
Protein Length:
66
Fln nts:
C
Fln Alignment:
AllPine_b_c40516___PPGTGKSSTVAAMANYLHYDIYDLELTKVNNNWELRMLLMQTSNKSIIVIEDID
B8LKR9________________PPGTGKSSMIAAMANYLHYNIYDLELTKVNDNSELRMLLMQTSNKSIIVIEDID
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain