|
||||||
|
UniGene Name: sp_v3.0_unigene198063
Length: 103 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene198063
C |
|
Ace file of the UniGene sp_v3.0_unigene198063
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pfam01762, Galactosyl_T, Galactosyltransferase | - | - | 9.0e-05 | 35% |
| FL-Next | sp=Probable beta-1,3-galactosyltransferase 12; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 87% |
| Sma3 | Beta-1,3-galactosyltransferase sqv-2, putative | - | - | 5.15e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 9.262e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycosaminoglycan biosynthesis - chondroitin sulfate | 00532 | 1.501e-06 | % | |
| Sma3 | Glycosaminoglycan biosynthesis - heparan sulfate | 00534 | 1.501e-06 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.501e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g53290; At2g26100; At3g14960; B3GALT12; B3GALT13; B3GALT14; F12M16.19; GSVIVT00027800001; GSVIVT00032209001; K15M2.10; OSJNBa0007C23.15; OSJNBa0017O06.7; Os05g0199500; Os06g0156900; OsI_18800; OsI_21744; OsJ_17464; OsJ_20186; P0046E09.18; PHYPADRAFT_21 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Golgi membrane | GO:0000139 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | galactosyltransferase activity | GO:0008378 | Molecular Function | 0.0 | - |
| Sma3 | manganese ion binding | GO:0030145 | Molecular Function | 0.0 | - |
| Sma3 | protein glycosylation | GO:0006486 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycosyl transferase, family 31 | IPR002659 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G26100.1 | Galactosyltransferase family protein chr2:11116212-11118129 REVERSE LENGTH=371 | 7.0e-14 | 87% |
| RefSeq | Arabidopsis thaliana | NP_180179.2 | putative beta-1,3-galactosyltransferase 12 [Arabidopsis thaliana] | 1.0e-13 | 87% |
| RefSeq | Populus trichocarpa | XP_002317466.1 | predicted protein, partial [Populus trichocarpa] | 9.0e-15 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q66GS2
Fln msg: Distance to subject end: 141 aas, your sequence is shorter than subject: 33 - 371
Fln protein:
F
Protein Length:
34
Fln nts:
C
Fln Alignment:
AllPine_b_c39648___FFKAAYALFDADFYVKADDDIYLRPDRLATLLA
Q66GS2________________FFKAAFKLFEADYYVKADDDIYLRPDRLATLLA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
