UniGene Name: sp_v3.0_unigene197984
Length: 156 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene197984
C |
Ace file of the UniGene sp_v3.0_unigene197984
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9STF3.1|PP265_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g46790, chloroplastic; AltName: Full=Protein CHLORORESPIRATORY REDUCTION 2; Flags: Precursor emb|CAB511 | - | - | 4.0e-13 | 66% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
| Source | Gene names |
|---|---|
| Sma3 | At3g46790; At4g16835; At5g04780; At5g44230; B1032F05.19; CRR2; DYW10; FCAALL.441; GSVIVT00000114001; GSVIVT00004379001; GSVIVT00008013001; GSVIVT00008660001; GSVIVT00013464001; GSVIVT00013497001; GSVIVT00013819001; GSVIVT00016277001; GSVIVT00018056001; GS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | chloroplast RNA processing | GO:0031425 | Biological Process | 0.0 | - |
| Sma3 | polycistronic mRNA processing | GO:0031426 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aminotransferase, class V/Cysteine desulfurase | IPR000192 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Armadillo | IPR000225 | - | 0.0 | - |
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Kinesin, motor domain | IPR001752 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Protein Transporter, Pam16 | IPR005341 | - | 0.0 | - |
| Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Armadillo-like helical | IPR011989 | - | 0.0 | - |
| Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G46790.1 | CRR2 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:17231975-17233948 REVERSE LENGTH=657 | 7.0e-18 | 66% |
| RefSeq | Arabidopsis thaliana | NP_190263.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-17 | 66% |
| RefSeq | Populus trichocarpa | XP_002313416.1 | predicted protein [Populus trichocarpa] | 3.0e-17 | 66% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQA8
Fln msg: Distance to subject end: 147 aas, your sequence is shorter than subject: 51 - 795
Fln protein:
L
Protein Length:
52
Fln nts:
C
Fln Alignment:
AllPine_b_c39508___LLGACRVHYNIELAEQATKQLFELEPNNAGNYVLLSNIYAEACRWEDVVRV
B8LQA8________________LLGACRIHCNIELGEQAAKHLFELDPDNAGYYVLLSNIYAEAQRWEDVAKL

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta