|
||||||
|
UniGene Name: sp_v3.0_unigene196873
Length: 217 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene196873
C |
|
Ace file of the UniGene sp_v3.0_unigene196873
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Plasma membrane ATPase n=11 Tax=Magnoliophyta RepID=PMA1_ORYSJ | - | - | 6.0e-23 | 76% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | Plasma membrane H+-ATPase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Adenosinetriphosphatase. | EC:3.6.1.3 | - | 8.324e-19 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Purine metabolism | 00230 | 8.324e-19 | % | |
| Sma3 | Transferred entry: 3.6.3.6. | EC:3.6.1.35 | - | 8.69e-30 | - |
| Sma3 | Proton-exporting ATPase. | EC:3.6.3.6 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidative phosphorylation | 00190 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AHA1; AHA10; AHA11; AHA2; AHA3; AHA4; AHA5; AHA6; AHA7; AHA8; AHA9; AT4G30190; ATP1; Aa_42640; At1g17260; At1g80660; At2g07560; At2g18960; At2g24520; At3g42640; At3g47950; At3g60330; At4g11730; At4g30190; At5g57350; At5g62670; BHA-1; Cr_42640; DcPA 1; DcP |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | hydrogen-exporting ATPase activity, phosphorylative mechanism | GO:0008553 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, uncoupled | GO:0042624 | Molecular Function | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | vacuole organization | GO:0007033 | Biological Process | 0.0 | - |
| Sma3 | vacuolar acidification | GO:0007035 | Biological Process | 0.0 | - |
| Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | proanthocyanidin biosynthetic process | GO:0010023 | Biological Process | 0.0 | - |
| Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
| Sma3 | proton transport | GO:0015992 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ATPase, P-type, H+ transporting proton pump | IPR000695 | - | 0.0 | - |
| Sma3 | ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter | IPR001757 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation-transporter, N-terminal | IPR004014 | - | 0.0 | - |
| Sma3 | Haloacid dehalogenase-like hydrolase | IPR005834 | - | 0.0 | - |
| Sma3 | ATPase, P-type cation exchange, alpha subunit | IPR006069 | - | 0.0 | - |
| Sma3 | ATPase, P-type, plasma-membrane proton-efflux | IPR006534 | - | 0.0 | - |
| Sma3 | ATPase, P-type, ATPase-associated domain | IPR008250 | - | 0.0 | - |
| Sma3 | Ribosomal protein S2, conserved site | IPR018130 | - | 0.0 | - |
| Sma3 | ATPase, P-type phosphorylation site | IPR018303 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G07560.1 | AHA6, HA6 H(+)-ATPase 6 chr2:3170394-3173952 REVERSE LENGTH=949 | 3.0e-26 | 68% |
| RefSeq | Arabidopsis thaliana | NP_179486.1 | H(+)-ATPase 1 [Arabidopsis thaliana] | 4.0e-26 | 70% |
| RefSeq | Populus trichocarpa | XP_002329641.1 | autoinhibited H+ ATPase [Populus trichocarpa] | 1.0e-29 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQS1
Fln msg: Distance to subject end: 158 aas, your sequence is shorter than subject: 72 - 955
Fln protein:
T
Protein Length:
73
Fln nts:
C
Fln Alignment:
AllPine_b_c37564___TYLATMTVIFFWAMYDHQFFTEKFGVRPLRTN-NECMAALYLQVSIVSQALIFVTRSRSWSFLERPGLLLVIA
B8LQS1________________TYLAVMTVIFFWAMHKTDFFPNKFGVRPIRDSPHELTSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLMTA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
