SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene196620

Length: 280 nt

UniGene Fasta

>sp_v3.0_unigene196620
ATATGTATGTCCAAAGATTGGGCAGGAATCACGAGAAGGAAAGTGTAATTAATCAGTAGCGAAGCAGAGAGGCACATAGGAAACTAATCATGGGACGCGCTCCTTGTTGTGGTGATCATGAAGGACTTAAGAGAGGACCCTGGACGGCCGAAGAGGACCAGAAGCTCATCGATCATGTTCAACACCATGGGGTTGGCAGTTGGCGCACCCTTCCAAAAATTGCAGGTATTCTGCTGTTGTGCACTGTATTATTATTCATATTCTACTGTGGATTCATCCT

Ace file of the UniGene sp_v3.0_unigene196620

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	R2R3-MYB transcription factor MYB11 n=1 Tax=Picea glauca RepID=A5JYF5_PICGL	-	-	2.0e-14	75%
FL-Next	tr=R2R3-MYB transcription factor MYB11; Picea glauca (White spruce) (Pinus glauca).	-	-	0.0	75%
Sma3	MYB transcription factor	-	-	4.192e-16	-

Source	Gene names
Sma3	AT4g21440; At1g34670; At1g74080; At2g47460; At3g01140; At3g02940; At3g61250; At4g05100; At4g21440; At4g28110; At5g15310; At5g16770; At5g49330; DcMYB2; F13E7.11; F18E5.60; F21H2.9; F2P9.5; F5E19_110; F8M21_200; GSVIVT00003904001; GSVIVT00006679001; GSVIVT0

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	methyltransferase activity	GO:0008168	Molecular Function	-
Sma3	transcription activator activity	GO:0016563	Molecular Function	-
Sma3	cell morphogenesis	GO:0000902	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	response to stress	GO:0006950	Biological Process	-
Sma3	response to salt stress	GO:0009651	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	response to gibberellin stimulus	GO:0009739	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	flavonoid biosynthetic process	GO:0009813	Biological Process	-
Sma3	trichome branching	GO:0010091	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	cell growth	GO:0016049	Biological Process	-
Sma3	cuticle development	GO:0042335	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	SANT/Myb domain	IPR001005	-	-
Sma3	DNA methylase, N-6 adenine-specific, conserved site	IPR002052	-	-
Sma3	Myb-related protein P, C-terminal	IPR010588	-	-
Sma3		IPR012287	-	-
Sma3		IPR014778	-	-
Sma3	Myb transcription factor	IPR015495	-	-
Sma3	Myb-like domain	IPR017877	-	-
Sma3	Myb domain, DNA-binding	IPR017930	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G28110.1	AtMYB41, MYB41 myb domain protein 41 chr4:13968166-13969384 REVERSE LENGTH=282	9.0e-19	70%
RefSeq	Arabidopsis thaliana	NP_194540.1	myb domain protein 41 [Arabidopsis thaliana]	1.0e-18	70%
RefSeq	Populus trichocarpa	XP_002305647.1	predicted protein [Populus trichocarpa]	5.0e-19	72%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: A5JYF5

Fln msg: Distance to subject end: 436 aas, your sequence is shorter than subject: 63 - 499

Fln protein: MGRAPCCGDHEGLKRGPWTAEEDQKLIDHVQHHGVGSWRTLPKIAGILLLCTVLLFIFYCGFI

Protein Length: 64

Fln nts: ATATGTATGTCCAAAGATTGGGCAGGAATCACGAGAAGGAAAGTGTAATTAATCAGTAGCGAAGCAGAGAGGCACATAGGAAACTAATC_-_ATGGGACGCGCTCCTTGTTGTGGTGATCATGAAGGACTTAAGAGAGGACCCTGGACGGCCGAAGAGGACCAGAAGCTCATCGATCATGTTCAACACCATGGGGTTGGCAGTTGGCGCACCCTTCCAAAAATTGCAGGTATTCTGCTGTTGTGCACTGTATTATTATTCATATTCTACTGTGGATTCATCCT

Fln Alignment:

AllPine_b_c37060___MGRAPCCGDHEGLKRGPWTAEEDQKLIDHVQHHGVGSWRTLPKIAGIL
A5JYF5________________MGRAPCC-DKDGLKKGPWTPEEDQKLTDYIQRHGHGSWRTLPKHAGLL

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain