UniGene Name: sp_v3.0_unigene195596
Length: 187 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene195596
T |
Ace file of the UniGene sp_v3.0_unigene195596
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cytochrome P450 [Pyrus communis] | - | - | 5.0e-14 | 62% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 85% |
| Sma3 | Cytochrome P450 | - | - | 3.205e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:1.14.-.- | - | 9.852e-09 | - | |
| Sma3 | Licodione synthase. | EC:1.14.13.87 | - | 6.047e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | Asp-3; At3g48290; At3g48320; CYP71A10; CYP71A21; CYP71A24; CYP71A9; CYP71AJ2; CYP71D4; CYP71D6; CYP71D7; CYP736A3v1; CYP736A4v1; CYP736A5v1; CYP736A8v1; CYP736A8v2; CYP736A8v3; CYP736A9; CYP92A24; CYP92A25; GSVIVT00015943001; GSVIVT00016433001; GSVIVT0001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | GO:0050381 | Molecular Function | 0.0 | - | |
| Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Protein of unknown function DUF247, plant | IPR004158 | - | 0.0 | - |
| Sma3 | Lipoxygenase, C-terminal | IPR013819 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G48290.2 | CYP71A24 cytochrome P450, family 71, subfamily A, polypeptide 24 chr3:17882596-17884134 FORWARD LENGTH=512 | 2.0e-15 | 60% |
| RefSeq | Arabidopsis thaliana | NP_680108.2 | cytochrome P450 71A24 [Arabidopsis thaliana] | 2.0e-15 | 60% |
| RefSeq | Populus trichocarpa | XP_002310005.1 | cytochrome P450 [Populus trichocarpa] | 4.0e-20 | 63% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQV6
Fln msg: Distance to subject end: 398 aas, your sequence is shorter than subject: 62 - 517
Fln protein:
L
Protein Length:
63
Fln nts:
T
Fln Alignment:
AllPine_b_c35344___LHLLGQLPHQALAALSLKFGPLMSLRLGSALTLVVSSPDMAKEFLKTHDLLFASRPPSAA
C0PQV6________________LHLMGRLQHKALAALSVKYGPLFSLRLGSALTLVVSSPDMAKEFLKTHDLVFASRPPSTA

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta