UniGene Name: sp_v3.0_unigene195445
Length: 210 nt
![]() |
---|
>sp_v3.0_unigene195445
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Histidine kinase 1 plant, putative n=1 Tax=Ricinus communis RepID=B9SUH7_RICCO | - | - | 1.0e-21 | 73% |
FL-Next | sp=Histidine kinase 1; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 86% |
Sma3 | Histidine kinase 1 plant, putative | - | - | 2.205e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Histidine kinase. | EC:2.7.13.3 | - | 2.882e-08 | - |
Source | Gene names |
---|---|
Sma3 | At2g17820; GSVIVT00036756001; PHYPADRAFT_115730; PHYPADRAFT_119819; PHYPADRAFT_122612; PHYPADRAFT_124824; PHYPADRAFT_141514; PHYPADRAFT_5010; PHYPADRAFT_64481; POPTRDRAFT_593825; POPTRDRAFT_757135; POPTRDRAFT_793555; POPTRDRAFT_872753; POPTRDRAFT_898811; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | two-component sensor activity | GO:0000155 | Molecular Function | 0.0 | - |
Sma3 | two-component response regulator activity | GO:0000156 | Molecular Function | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | osmosensor activity | GO:0005034 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | histidine phosphotransfer kinase activity | GO:0009927 | Molecular Function | 0.0 | - |
Sma3 | two-component signal transduction system (phosphorelay) | GO:0000160 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | peptidyl-histidine phosphorylation | GO:0018106 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Signal transduction response regulator, receiver domain | IPR001789 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | ATPase-like, ATP-binding domain | IPR003594 | - | 0.0 | - |
Sma3 | Signal transduction histidine kinase, subgroup 1, dimerisation/phosphoacceptor domain | IPR003661 | - | 0.0 | - |
Sma3 | Signal transduction histidine kinase-related protein, C-terminal | IPR004358 | - | 0.0 | - |
Sma3 | Signal transduction histidine kinase, core | IPR005467 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G17820.1 | ATHK1, AHK1, HK1 histidine kinase 1 chr2:7743133-7748013 REVERSE LENGTH=1207 | 1.0e-25 | 86% |
RefSeq | Arabidopsis thaliana | NP_565424.1 | histidine kinase 1 [Arabidopsis thaliana] | 2.0e-25 | 86% |
RefSeq | Populus trichocarpa | XP_002303406.1 | histidine kinase osmosensor protein [Populus trichocarpa] | 3.0e-27 | 86% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9SXL4
Fln msg: Distance to subject end: 452 aas, your sequence is shorter than subject: 69 - 1207
Fln protein:
T
Protein Length:
70
Fln nts:
T
Fln Alignment:
AllPine_b_c35087___LWFEVEDTGCGIDCSKWESVFESFEQADPSXXXXXXXXXXXXCIVRSLVNKMGGQIKVVRKEGPGTLM
Q9SXL4________________LWFEVDDTGCGIDPSKWDSVFESFEQADPSTTRTHGGTGLGLCIVRNLVNKMGGEIKVVQKNGLGTLM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain