|
||||||
|
UniGene Name: sp_v3.0_unigene195090
Length: 190 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene195090
C |
|
Ace file of the UniGene sp_v3.0_unigene195090
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Aldehyde oxidase 2 n=2 Tax=Arabidopsis RepID=ALDO2_ARATH | - | - | 4.0e-05 | 52% |
| FL-Next | sp=Indole-3-acetaldehyde oxidase; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 52% |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Aldehyde oxidase. | EC:1.2.3.1 | - | 1.031e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Valine, leucine and isoleucine degradation | 00280 | 1.031e-06 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 1.031e-06 | % | |
| Sma3 | Tryptophan metabolism | 00380 | 1.031e-06 | % | |
| Sma3 | Vitamin B6 metabolism | 00750 | 1.031e-06 | % | |
| Sma3 | Nicotinate and nicotinamide metabolism | 00760 | 1.031e-06 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 1.031e-06 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.031e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | AAO1; AAO2; AO1; AO3; At3g43600; At5g20960; BrAO1; F22D1.130; F22J12.40; GSVIVT00017483001; GSVIVT00021879001; PHYPADRAFT_106708; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | aldehyde oxidase activity | GO:0004031 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | molybdenum ion binding | GO:0030151 | Molecular Function | 0.0 | - |
| Sma3 | indole-3-acetaldehyde oxidase activity | GO:0050302 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
| Sma3 | 2 iron, 2 sulfur cluster binding | GO:0051537 | Molecular Function | 0.0 | - |
| Sma3 | abscisic acid biosynthetic process | GO:0009688 | Biological Process | 0.0 | - |
| Sma3 | auxin biosynthetic process | GO:0009851 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Oxidoreductase, molybdopterin-binding domain | IPR000572 | - | 0.0 | - |
| Sma3 | Aldehyde oxidase/xanthine dehydrogenase, a/b hammerhead | IPR000674 | - | 0.0 | - |
| Sma3 | 2Fe-2S ferredoxin-type domain | IPR001041 | - | 0.0 | - |
| Sma3 | Molybdopterin dehydrogenase, FAD-binding | IPR002346 | - | 0.0 | - |
| Sma3 | [2Fe-2S]-binding | IPR002888 | - | 0.0 | - |
| Sma3 | CO dehydrogenase flavoprotein, C-terminal | IPR005107 | - | 0.0 | - |
| Sma3 | 2Fe-2S ferredoxin, iron-sulphur binding site | IPR006058 | - | 0.0 | - |
| Sma3 | Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding | IPR008274 | - | 0.0 | - |
| Sma3 | Beta-grasp domain | IPR012675 | - | 0.0 | - |
| Sma3 | FAD-binding, type 2 | IPR016166 | - | 0.0 | - |
| Sma3 | CO dehydrogenase flavoprotein-like, FAD-binding, subdomain 2 | IPR016169 | - | 0.0 | - |
| Sma3 | Aldehyde oxidase/xanthine dehydrogenase | IPR016208 | - | 0.0 | - |
| Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: sp_plants
Fln subject: Q7G192
Fln msg: Distance to subject end: 1269 aas, your sequence is shorter than subject: 58 - 1321
Fln protein:
M
Protein Length:
59
Fln nts:
C
Fln Alignment:
AllPine_b_c34442___LVIGLNGQRIEVDLSQIDPATTVLDYLRYHTEYRGAKL
Q7G192________________LVFAINGQRFELELSSVDPSTTLLEFLRYQTSFKSVKL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
