UniGene Name: sp_v3.0_unigene195039
Length: 118 nt
UniGene Fasta |
---|
>sp_v3.0_unigene195039
A |
Ace file of the UniGene sp_v3.0_unigene195039 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | UDP-glucosyltransferase family protein (Fragment) n=6 Tax=Pseudotsuga RepID=C6F8W3_PSEMZ | - | - | 1.0e-14 | 94% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 100% |
Sma3 | Glucosyltransferase | - | - | 2.721e-21 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Glycosyltransferases, Hexosyltransferases. | EC:2.4.1.- | - | 1.1e-09 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Anthocyanin biosynthesis | 00942 | 3.854e-28 | % | |
Sma3 | Metabolic pathways | 01100 | 3.854e-28 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.854e-28 | % | |
Sma3 | Hydroquinone glucosyltransferase. | EC:2.4.1.218 | - | 9.184e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT1G22360; AT3G16520; A_IG002N01.15; AdGt-1; AdGt-10; AdGt-11; AdGt-12; AdGt-14; AdGt-2; AdGt-5; AdGt-9; AmUGT21; AmUGT36; AmUGT38; At1g22340; At1g22360; At1g22360/T16E15.3; At1g22370; At1g22400; At1g78270; At2g36750; At2g36760; At2g36770; At2g36780; At2g |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | glucuronosyltransferase activity | GO:0015020 | Molecular Function | 0.0 | - |
Sma3 | transferase activity, transferring hexosyl groups | GO:0016758 | Molecular Function | 0.0 | - |
Sma3 | UDP-glucosyltransferase activity | GO:0035251 | Molecular Function | 0.0 | - |
Sma3 | trans-zeatin O-beta-D-glucosyltransferase activity | GO:0050403 | Molecular Function | 0.0 | - |
Sma3 | cis-zeatin O-beta-D-glucosyltransferase activity | GO:0050502 | Molecular Function | 0.0 | - |
Sma3 | hydroquinone glucosyltransferase activity | GO:0050505 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | response to toxin | GO:0009636 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
Sma3 | brassinosteroid metabolic process | GO:0016131 | Biological Process | 0.0 | - |
Sma3 | xenobiotic catabolic process | GO:0042178 | Biological Process | 0.0 | - |
Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
Sma3 | response to other organism | GO:0051707 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
Sma3 | UDP-glucuronosyl/UDP-glucosyltransferase | IPR002213 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | ATPase, AAA-2 | IPR013093 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G22360.1 | AtUGT85A2, UGT85A2 UDP-glucosyl transferase 85A2 chr1:7895068-7897527 REVERSE LENGTH=481 | 2.0e-18 | 76% |
RefSeq | Arabidopsis thaliana | NP_564170.1 | UDP-glucosyl transferase 85A5 [Arabidopsis thaliana] | 2.0e-18 | 79% |
RefSeq | Populus trichocarpa | XP_002307921.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-19 | 79% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVD1
Fln msg: Distance to subject end: 86 aas, your sequence is shorter than subject: 39 - 298
Fln protein:
W
Protein Length:
40
Fln nts:
A
Fln Alignment:
AllPine_b_c34333___WAPQMKVLSHPSVGGFLTHSGWNSTLESICAGVPMISWP
A9NVD1________________WAPQMKVLSHPSVGGFLTHSGWNSTLESICAGVPMISWP
SNPs (tot: 10) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
25 | 33 | 66 | 0.997476 | ||
28 | 33 | 66 | 0.997476 | ||
46 | 66 | 33 | 0.997476 | ||
52 | 33 | 66 | 0.997461 | ||
55 | 66 | 33 | 0.997464 | ||
62 | 66 | 33 | 0.997476 | ||
65 | 66 | 33 | 0.997464 | ||
71 | 33 | 66 | 0.997456 | ||
74 | 66 | 33 | 0.997476 | ||
77 | 33 | 66 | 0.997476 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain