SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene194378

Length: 439 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene194378
ATACAGACAGTACTACCATCAGATGCAGATTGTAGTTTCTTCATTTGAAGCTGCCGCTGGGTATGGAGCTGCCAAGACATACACTTCTCTTGCTCTGCAAACAATATCGAGGCACTTCCGATGTTTGAGAGATGCAATCAGTGGACAAATTCGGCTGAACCAAGACAAAAAGTTTAGGGTAGAAAGAAGATTCAACAGTGAGTGGAAAAGGTGAAACATCTCGTCTCCGTTTTGTGGACCAGCAATTGCGGCAACAACGGGCTCTCCAACAATTAGGCATGATTCAGCAGCATGCTTGGAGGCCACAGAGAGGACTTCCTGAACGATCTGTTTCTGTCTTACGGGCTTGGCTATTTGAACATTTCCTTCATCCGTATCCAAAAGATGCAGACAAACACATGCTTGCGAGACAGACTGGTCTTACCAGAAATCAGGTCTC

Ace file of the UniGene sp_v3.0_unigene194378 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	BEL1-related homeotic protein 30 [Solanum tuberosum]	-	-	2.0e-40	68%
FL-Next	sp=BEL1-like homeodomain protein 1; Arabidopsis thaliana (Mouse-ear cress).	-	-	0.0	72%
Sma3	Bel1 homeotic protein, putative	-	-	7.773e-28	-

Source	Gene names
Sma3	AP22.90; ATH1; At1g19700; At1g75410; At1g75430; At2g16400; At2g23760; At2g27220; At2g27990; At2g35940; At4g32980; At4g34610; At4g36870; At5g02030; At5g41410; BEL1; BELL1; BIHD1; BIP; BL1; BL2; BL3; BL4; BLH1; BLH10; BLH11; BLH2; BLH3; BLH4; BLH5; BLH6; BL

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	protein homodimerization activity	GO:0042803	Molecular Function	-
Sma3	sequence-specific DNA binding	GO:0043565	Molecular Function	-
Sma3	protein heterodimerization activity	GO:0046982	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	oligopeptide transport	GO:0006857	Biological Process	-
Sma3	negative regulation of cell proliferation	GO:0008285	Biological Process	-
Sma3	response to symbiotic fungus	GO:0009610	Biological Process	-
Sma3	photomorphogenesis	GO:0009640	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	xylem and phloem pattern formation	GO:0010051	Biological Process	-
Sma3	maintenance of floral meristem identity	GO:0010076	Biological Process	-
Sma3	maintenance of inflorescence meristem identity	GO:0010077	Biological Process	-
Sma3	fruit development	GO:0010154	Biological Process	-
Sma3	polar nucleus fusion	GO:0010197	Biological Process	-
Sma3	secondary shoot formation	GO:0010223	Biological Process	-
Sma3	floral organ abscission	GO:0010227	Biological Process	-
Sma3	vegetative to reproductive phase transition of meristem	GO:0010228	Biological Process	-
Sma3	inflorescence development	GO:0010229	Biological Process	-
Sma3	regulation of gibberellin biosynthetic process	GO:0010371	Biological Process	-
Sma3		GO:0016481	Biological Process	-
Sma3		GO:0045449	Biological Process	-
Sma3	floral whorl morphogenesis	GO:0048457	Biological Process	-
Sma3	regulation of timing of transition from vegetative to reproductive phase	GO:0048510	Biological Process	-
Sma3	organ formation	GO:0048645	Biological Process	-
Sma3	internode patterning	GO:0080006	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Oligopeptide transporter	IPR000109	-	-
Sma3	Homeodomain	IPR001356	-	-
Sma3	Alcohol dehydrogenase, zinc-type, conserved site	IPR002328	-	-
Sma3	POX	IPR006563	-	-
Sma3	Protein of unknown function DUF604	IPR006740	-	-
Sma3		IPR012287	-	-
Sma3	Homeobox, conserved site	IPR017970	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G35940.1	BLH1, EDA29 BEL1-like homeodomain 1 chr2:15089171-15091699 REVERSE LENGTH=680	1.0e-39	77%
RefSeq	Arabidopsis thaliana	NP_850256.1	BEL1-like homeodomain 1 [Arabidopsis thaliana]	2.0e-39	77%
RefSeq	Populus trichocarpa	XP_002308323.1	predicted protein [Populus trichocarpa]	1.00053e-42	81%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: sp_plants

Fln subject: Q9SJ56

Fln msg: Separated hits, possible frame ERROR between 154 and 168, Distance to subject end: 247 aas, your sequence is shorter than subject: 146 - 680

Fln protein: YRQYYHQMQIVVSSFEAAAGYGAAKTYTSLALQTISRHFRCLRDAISGQIxxxxxxKSLG*KEDSTVSGKGETSRLRFVDQQLRQQRALQQLGMIQQHAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDADKHMLARQTGLTRNQV

Protein Length: 147

Fln nts: ATACAGACAGTACTACCATCAGATGCAGATTGTAGTTTCTTCATTTGAAGCTGCCGCTGGGTATGGAGCTGCCAAGACATACACTTCTCTTGCTCTGCAAACAATATCGAGGCACTTCCGATGTTTGAGAGATGCAATCAGTGGACAAATTCGxxxxxxxxxxxxxxxAAAAAGTTTAGGGTAGAAAGAAGATTCAACAGTGAGTGGAAAAGGTGAAACATCTCGTCTCCGTTTTGTGGACCAGCAATTGCGGCAACAACGGGCTCTCCAACAATTAGGCATGATTCAGCAGCATGCTTGGAGGCCACAGAGAGGACTTCCTGAACGATCTGTTTCTGTCTTACGGGCTTGGCTATTTGAACATTTCCTTCATCCGTATCCAAAAGATGCAGACAAACACATGCTTGCGAGACAGACTGGTCTTACCAGAAATCAGGTCTC

Fln Alignment:

AllPine_b_c33210___YRQYYHQMQIVVSSFEXXXXXXXXXXXTSLALQTISRHFRCLRDAISGQIRxxxxxKSLG*KEDSTVSGKG--ETSRLRFVDXXXXXXXXXXXLGMIQQ---HAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDADKHMLARQTGLTRNQV
Q9SJ56________________YRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKxxxxxKSLG--EEDSVSGVGRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQV

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain