UniGene Name: sp_v3.0_unigene194238
Length: 200 nt
![]() |
---|
>sp_v3.0_unigene194238
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Transcription repressor MYB4 n=6 Tax=Brassicaceae RepID=MYB4_ARATH | - | - | 2.0e-28 | 86% |
FL-Next | tr=R2R3-MYB transcription factor MYB10; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 83% |
Sma3 | MYB transcription factor | - | - | 3.51e-15 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_17; ATR1; At1g09540; At1g22640; At1g35515; At1g74080; At2g16720; At2g47460; At3g62610; At4g09460; At4g21440; At4g34990; At4g38620; At5g10280; At5g16770; At5g54230; At5g54230/MDK4.5; At5g60890; B1053A04.9; DcMYB1; DcMYB5; F12K8.1; F14J9.20; F18D22_5 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | tryptophan biosynthetic process | GO:0000162 | Biological Process | 0.0 | - |
Sma3 | defense response to insect | GO:0002213 | Biological Process | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | indole glucosinolate biosynthetic process | GO:0009759 | Biological Process | 0.0 | - |
Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
Sma3 | cellular response to sulfur starvation | GO:0010438 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ketose-bisphosphate aldolase, class-II | IPR000771 | - | 0.0 | - |
Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | IPR012287 | - | 0.0 | - | |
Sma3 | IPR014778 | - | 0.0 | - | |
Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
Sma3 | Myb-like domain | IPR017877 | - | 0.0 | - |
Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38620.1 | ATMYB4, MYB4 myb domain protein 4 chr4:18053866-18054876 FORWARD LENGTH=282 | 2.0e-37 | 86% |
RefSeq | Arabidopsis thaliana | NP_195574.1 | transcription repressor MYB4 [Arabidopsis thaliana] | 2.0e-37 | 86% |
RefSeq | Populus trichocarpa | XP_002327745.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-37 | 83% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: A5JYF4
Fln msg: Distance to subject end: 133 aas, atg_distance in limit (1-15): atg_distance = 12, W2: There is no M at the beginning, your sequence is shorter than subject: 66 - 210
Fln protein:
T
Protein Length:
67
Fln nts:
T
Fln Alignment:
AllPine_b_c32959___TNKGAWSKDEDEALVAYIQAHGEGSWRSLPKAAGLQRCGKSCRLRWINYLRPDLKRGNFSPEEDEI
A5JYF4________________TNKGAWTKEEDDRLIAHIRAHGEGGWRSLPKAAGLLRCGKSCRLRWINYLRPDLKRGNFSEEEDEL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain