|
||||||
|
UniGene Name: sp_v3.0_unigene194022
Length: 246 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene194022
G |
|
Ace file of the UniGene sp_v3.0_unigene194022
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | putative cucumisin-like serine protease [Oryza sativa Japonica Group] gb|AAP53584.1| Subtilisin N-terminal Region family protein, expressed [Oryza sativa Japonica Group] | - | - | 3.0e-20 | 54% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 49% |
| Sma3 | Xylem serine proteinase 1, putative | - | - | 8.939e-24 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cucumisin. | EC:3.4.21.25 | - | 2.101e-22 | - |
| Source | Gene names |
|---|---|
| Sma3 | 46C02.13; A43; At1g01900; At2g05920; At3g14240; At5g51750; F22M8.3; GSVIVT00000484001; GSVIVT00001034001; GSVIVT00001051001; GSVIVT00001054001; GSVIVT00001056001; GSVIVT00001075001; GSVIVT00004225001; GSVIVT00004387001; GSVIVT00005977001; GSVIVT0000820200 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | extracellular matrix | GO:0031012 | Cellular Component | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | identical protein binding | GO:0042802 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of catalytic activity | GO:0043086 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | RNA helicase, ATP-dependent, DEAD-box, conserved site | IPR000629 | - | 0.0 | - |
| Sma3 | Signal recognition particle, SRP54 subunit, GTPase | IPR000897 | - | 0.0 | - |
| Sma3 | Protease-associated domain, PA | IPR003137 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I9 | IPR010259 | - | 0.0 | - |
| Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
| Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
| Sma3 | Peroxisome membrane protein, Pex16 | IPR013919 | - | 0.0 | - |
| Sma3 | Peptidase S8, subtilisin-related | IPR015500 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
| Sma3 | Peptidase S10, serine carboxypeptidase, active site | IPR018202 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G34980.1 | SLP2 subtilisin-like serine protease 2 chr4:16656929-16659223 REVERSE LENGTH=764 | 4.0e-23 | 47% |
| RefSeq | Arabidopsis thaliana | NP_567972.1 | subtilisin-like serine protease 2 [Arabidopsis thaliana] | 6.0e-23 | 47% |
| RefSeq | Populus trichocarpa | XP_002317030.1 | predicted protein [Populus trichocarpa] | 2.0e-32 | 67% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AE86
Fln msg: Distance to subject end: 167 aas, your sequence is shorter than subject: 82 - 394
Fln protein:
G
Protein Length:
83
Fln nts:
G
Fln Alignment:
AllPine_b_c32527___GLNILAAWSPV---------KKGMHFNIASGTSMACPHVSGIAALIKAAHPSWTPSAIKSALMTTANVLDKNKKIMTAAPRGRTANPFGFG
D5AE86________________GVNILAGWTGAVGPSSLAIDRRRTQFNILSGTSMACPHVSGVAALLKGAHPQWSPAAVRSALMTTAYTQDNRGHRMIDEASGNASTPFDFG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
