UniGene Name: sp_v3.0_unigene193936
Length: 205 nt
![]() |
---|
>sp_v3.0_unigene193936
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glucose-1-phosphate adenylyltransferase n=1 Tax=Physcomitrella patens subsp. patens RepID=A9T6T4_PHYPA | - | - | 2.0e-21 | 74% |
FL-Next | sp=Glucose-1-phosphate adenylyltransferase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Glucose-1-phosphate adenylyltransferase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glucose-1-phosphate adenylyltransferase. | EC:2.7.7.27 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | ADG2; ADG2A; AGP-L1; AGP-S1; AGP-S2; AGPL; AGPLI-2; AGPLI-3; AGPLS3; AGPLS4; AGPS1; AGPS2; AGPS3; APL1; APL2; APL3; AT2G21590; AgpL1; At1g27680; At2g21590; At4g39210; At5g19220; CHLREDRAFT_205913; GSVIVT00014579001; GSVIVT00019926001; GSVIVT00028257001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | amyloplast | GO:0009501 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | glucose-1-phosphate adenylyltransferase complex | GO:0010170 | Cellular Component | 0.0 | - |
Sma3 | glucose-1-phosphate adenylyltransferase activity | GO:0008878 | Molecular Function | 0.0 | - |
Sma3 | nucleotidyltransferase activity | GO:0016779 | Molecular Function | 0.0 | - |
Sma3 | glycogen biosynthetic process | GO:0005978 | Biological Process | 0.0 | - |
Sma3 | starch biosynthetic process | GO:0019252 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Bacterial transferase hexapeptide repeat | IPR001451 | - | 0.0 | - |
Sma3 | Nucleotidyl transferase | IPR005835 | - | 0.0 | - |
Sma3 | ADP-glucose pyrophosphorylase, conserved site | IPR005836 | - | 0.0 | - |
Sma3 | Parallel beta-helix repeat | IPR006626 | - | 0.0 | - |
Sma3 | TonB box, conserved site | IPR010916 | - | 0.0 | - |
Sma3 | Glucose-1-phosphate adenylyltransferase | IPR011831 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G39210.1 | APL3 Glucose-1-phosphate adenylyltransferase family protein chr4:18260332-18263181 FORWARD LENGTH=521 | 7.0e-25 | 64% |
RefSeq | Arabidopsis thaliana | NP_195632.1 | glucose-1-phosphate adenylyltransferase large subunit 3 [Arabidopsis thaliana] | 1.0e-24 | 64% |
RefSeq | Populus trichocarpa | XP_002307668.1 | predicted protein, partial [Populus trichocarpa] | 2.0e-26 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LPE1
Fln msg: Distance to subject end: 309 aas, your sequence is shorter than subject: 68 - 525
Fln protein:
Q
Protein Length:
69
Fln nts:
C
Fln Alignment:
AllPine_b_c32381___SLNTSHFLRHMVLVNGVNFGDGFVEVLAATQTPGEDGMNWFQGTADAVRQFMWLFEDPRNRHIEHVI
B8LPE1________________SLNR-HLARAYSFCNGVNFGDGFVEVLAATQRPGEMGKNWFQGTADAVRQFAWLFEDAKNKEIDDIL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain