UniGene Name: sp_v3.0_unigene188680
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene188680
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | NAC domain protein, IPR003441 n=1 Tax=Populus trichocarpa RepID=B9MTA7_POPTR | - | - | 5.0e-24 | 80% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | NAC domain protein | - | - | 3.447e-39 | - |
Source | Gene names |
---|---|
Sma3 | ANAC; ANAC094; ATAF; ATAF1; At1g01720; At1g26870; At1g52880; At1g52890; At1g61110; At1g61110/F11P17_16; At1g69490; At1g77450; At1g77450/T5M16_4; At3g04070; At3g15500; At3g15510; At3g29035; At4g27410; At5g08790; At5g08790/T2K12_140; At5g08980; At5g39610; A |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | transcription activator activity | GO:0016563 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | regulation of cell size | GO:0008361 | Biological Process | 0.0 | - |
Sma3 | response to water deprivation | GO:0009414 | Biological Process | 0.0 | - |
Sma3 | response to light stimulus | GO:0009416 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | response to fungus | GO:0009620 | Biological Process | 0.0 | - |
Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
Sma3 | response to sucrose stimulus | GO:0009744 | Biological Process | 0.0 | - |
Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
Sma3 | negative regulation of abscisic acid mediated signaling pathway | GO:0009788 | Biological Process | 0.0 | - |
Sma3 | multidimensional cell growth | GO:0009825 | Biological Process | 0.0 | - |
Sma3 | jasmonic acid mediated signaling pathway | GO:0009867 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | leaf senescence | GO:0010150 | Biological Process | 0.0 | - |
Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
Sma3 | positive regulation of asymmetric cell division | GO:0045770 | Biological Process | 0.0 | - |
Sma3 | somatic stem cell division | GO:0048103 | Biological Process | 0.0 | - |
Sma3 | root cap development | GO:0048829 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | No apical meristem (NAM) protein | IPR003441 | - | 0.0 | - |
Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
Sma3 | Beta tubulin, autoregulation binding site | IPR013838 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G15510.1 | ATNAC2, ANAC056, NARS1, NAC2 NAC domain containing protein 2 chr3:5243696-5245037 FORWARD LENGTH=364 | 7.0e-30 | 73% |
RefSeq | Arabidopsis thaliana | NP_188170.1 | NAC domain containing protein 2 [Arabidopsis thaliana] | 9.0e-30 | 73% |
RefSeq | Populus trichocarpa | XP_002326347.1 | NAC domain protein, IPR003441 [Populus trichocarpa] | 3.0e-31 | 80% |
![]() |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5ABS0
Fln msg: Distance to subject end: 198 aas, your sequence is shorter than subject: 74 - 270
Fln protein:
M
Protein Length:
75
Fln nts:
A
Fln Alignment:
AllPine_b_c21772___MEGAEFHHQVLPQLPPGFRFHPTDEELLIHYLKNRISCSPLPASIIAEIDLYKHDPWDLPEKACFGEQEWYF
D5ABS0________________MEGLAFHQQVLLQLPVGFRFEPTDEELLIYYLKKKVSSSPFPGSVIAEIDLYKHDPWDLPAKAFFGEKEWYF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain