UniGene Name: sp_v3.0_unigene188386
Length: 176 nt
![]() |
---|
>sp_v3.0_unigene188386
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Protein kinase, putative n=1 Tax=Ricinus communis RepID=B9T446_RICCO | - | - | 1.0e-24 | 89% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Serine/threonine protein kinase | - | - | 1.172e-09 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 9.989e-07 | - |
Source | Gene names |
---|---|
Sma3 | AT4G31170; AT4g35780; AT4g38470; At1g62400; At2g17700; At2g24360; At4g31170; At4g35780; At4g38470; CHLREDRAFT_105918; CHLREDRAFT_116962; DPK1; DPK2; DPK3; DPK4; F20M13.30; F24O1.13; F8D20.290; GSVIVT00002272001; GSVIVT00011262001; GSVIVT00013151001; GSVIV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | amino acid binding | GO:0016597 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | regulation of stomatal movement | GO:0010119 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Amino acid-binding ACT | IPR002912 | - | 0.0 | - |
Sma3 | Uncharacterised protein family UPF0497, trans-membrane plant | IPR006702 | - | 0.0 | - |
Sma3 | Tyrosine-protein kinase, active site | IPR008266 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | IPR015783 | - | 0.0 | - | |
Sma3 | Serine/threonine-protein kinase, ATN1-like | IPR015784 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Peptidase S10, serine carboxypeptidase, active site | IPR018202 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G38470.1 | ACT-like protein tyrosine kinase family protein chr4:17999432-18003551 FORWARD LENGTH=575 | 8.0e-28 | 81% |
RefSeq | Arabidopsis thaliana | NP_568041.1 | ACT-like protein tyrosine kinase family protein [Arabidopsis thaliana] | 1.0e-27 | 81% |
RefSeq | Populus trichocarpa | XP_002300929.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-31 | 91% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSF3
Fln msg: Distance to subject end: 78 aas, your sequence is shorter than subject: 58 - 594
Fln protein:
Q
Protein Length:
59
Fln nts:
C
Fln Alignment:
AllPine_b_c21145___QSGLMTAETGTYRWMAPEVINHQPYDQKADVFSFAIVLWELLTAKLPYDSMTPLQAAL
C0PSF3________________QSGVMTAETGTYRWMAPEVIEHKPYDQKADVFSFGIVLWELLTGKLPYDYLTPLQAAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain