UniGene Name: sp_v3.0_unigene188342
Length: 242 nt
![]() |
---|
>sp_v3.0_unigene188342
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Aaa-metalloprotease chloroplast n=1 Tax=Micromonas sp. RCC299 RepID=C1FDU0_MICSR | - | - | 1.0e-33 | 83% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 91% |
Sma3 | Cell division protease ftsH homolog | - | - | 8.829e-16 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Metalloendopeptidases. | EC:3.4.24.- | - | 9.723e-32 | - |
Source | Gene names |
---|---|
Sma3 | AT2G30950; At1g06430; At2g30950; At5g15250; CHLREDRAFT_58334; F12K11.22; F12K11_24; F7F1.16; F8M21.140; FTSH2; FTSH6; FTSH8; FtsH2; FtsH2A; FtsH2B; GSVIVT00018790001; GSVIVT00020948001; Grc000065; Heak293_Cp148; LOC_Os06g12370; LOC_Os06g45820; LeftsH6; MI |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
Sma3 | metalloendopeptidase activity | GO:0004222 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
Sma3 | photoinhibition | GO:0010205 | Biological Process | 0.0 | - |
Sma3 | PSII associated light-harvesting complex II catabolic process | GO:0010304 | Biological Process | 0.0 | - |
Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
Sma3 | regulation of apoptotic process | GO:0042981 | Biological Process | 0.0 | - |
Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase M41 | IPR000642 | - | 0.0 | - |
Sma3 | Caspase Recruitment | IPR001315 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
Sma3 | Peptidase, FtsH | IPR005936 | - | 0.0 | - |
Sma3 | Twin-arginine translocation pathway, signal sequence | IPR006311 | - | 0.0 | - |
Sma3 | Peptidase M41, FtsH extracellular | IPR011546 | - | 0.0 | - |
Sma3 | IPR017909 | - | 0.0 | - | |
Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G06430.1 | FTSH8 FTSH protease 8 chr1:1960214-1962525 REVERSE LENGTH=685 | 8.00001e-41 | 83% |
RefSeq | Arabidopsis thaliana | NP_563766.3 | cell division protease ftsH-8 [Arabidopsis thaliana] | 9.99995e-41 | 83% |
RefSeq | Populus trichocarpa | XP_002332995.1 | predicted protein [Populus trichocarpa] | 4.99997e-41 | 82% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQE3
Fln msg: Distance to subject end: 139 aas, your sequence is shorter than subject: 80 - 264
Fln protein:
M
Protein Length:
81
Fln nts:
T
Fln Alignment:
AllPine_b_c21009___MEGTAMSDGKSKSLVAYHEVGHAICATLTPGHDPVQKVTLIPRGQARGLTWFLPEQDLSLITKEQIFARIVGALGGRAAE
A9NQE3________________MEGTAMTDGKSKSLVAYHEVGHAICATLTPGHDPVQKITLLPRGQARGLTWFLPGQDPSLISKGQIFARIVGALGGRAAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain