|
||||||
|
UniGene Name: sp_v3.0_unigene187298
Length: 193 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene187298
T |
|
Ace file of the UniGene sp_v3.0_unigene187298
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pyruvate kinase n=2 Tax=Picea sitchensis RepID=A9NUL1_PICSI | - | - | 1.0e-13 | 88% |
| FL-Next | sp=Pyruvate kinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Pyruvate kinase | - | - | 5.134e-30 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | EC:2.7.1.4- | - | 1.909e-32 | - |
| Source | Gene names |
|---|---|
| Sma3 | At2g36580; At3g52990; F8J2_160; GSVIVT00010814001; GSVIVT00021709001; LOC_Os11g05110; LOC_Os12g05110; MtrDRAFT_AC139525g8v2; Os11g0148500; Os12g0145700; OsI_31247; OsI_35105; OsI_37456; OsJ_32969; OsJ_35209; PHYPADRAFT_109480; PHYPADRAFT_159402; PHYPADRAF |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | pyruvate kinase activity | GO:0004743 | Molecular Function | 0.0 | - |
| Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Bromo adjacent homology (BAH) domain | IPR001025 | - | 0.0 | - |
| Sma3 | Pyruvate kinase | IPR001697 | - | 0.0 | - |
| Sma3 | Protein phosphatase 2C-like | IPR001932 | - | 0.0 | - |
| Sma3 | Zinc finger, PHD-type | IPR001965 | - | 0.0 | - |
| Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
| Sma3 | IPR014045 | - | 0.0 | - | |
| Sma3 | Protein phosphatase 2C | IPR015655 | - | 0.0 | - |
| Sma3 | Pyruvate kinase, barrel | IPR015793 | - | 0.0 | - |
| Sma3 | Pyruvate kinase, alpha/beta | IPR015794 | - | 0.0 | - |
| Sma3 | Pyruvate/Phosphoenolpyruvate kinase | IPR015813 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G52990.1 | Pyruvate kinase family protein chr3:19649046-19652237 FORWARD LENGTH=527 | 1.0e-16 | 77% |
| RefSeq | Arabidopsis thaliana | NP_566976.1 | pyruvate kinase [Arabidopsis thaliana] | 1.0e-16 | 77% |
| RefSeq | Populus trichocarpa | XP_002326407.1 | predicted protein [Populus trichocarpa] | 1.0e-16 | 79% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NUL1
Fln msg: Distance to subject end: 483 aas, your sequence is shorter than subject: 44 - 527
Fln protein:
M
Protein Length:
45
Fln nts:
T
Fln Alignment:
AllPine_b_c18467___MQGAQILLEEPIRMASILEPSKANFFPAMTKIIGTLGPQSRSVE
A9NUL1________________MQGAHLLLEEPIRMASILEPSKANFFHAMTKIVGTLGPNSRSVE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
