UniGene Name: sp_v3.0_unigene186363
Length: 238 nt
![]() |
---|
>sp_v3.0_unigene186363
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Endo-beta-mannanase n=1 Tax=Cucumis melo subsp. melo RepID=E5GCI6_CUCME | - | - | 1.0e-27 | 72% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 58% |
Sma3 | Hydrolase, hydrolyzing O-glycosyl compounds, putative | - | - | 1.429e-12 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mannan endo-1,4-beta-mannosidase. | EC:3.2.1.78 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At3g10890; At3g10900; At3g30540; At4g28320; At5g01930; At5g66460; F26K10.200; GSVIVT00010891001; GSVIVT00014580001; GSVIVT00018590001; GSVIVT00024894001; GSVIVT00032044001; GSVIVT00032045001; GSVIVT00032046001; GSVIVT00032047001; GSVIVT00032048001; GSVIVT |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | mannan endo-1,4-beta-mannosidase activity | GO:0016985 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5 | IPR001547 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G10890.1 | Glycosyl hydrolase superfamily protein chr3:3407455-3409000 REVERSE LENGTH=414 | 1.0e-28 | 56% |
RefSeq | Arabidopsis thaliana | NP_187700.1 | mannan endo-1,4-beta-mannosidase 3 [Arabidopsis thaliana] | 1.0e-28 | 56% |
RefSeq | Populus trichocarpa | XP_002306881.1 | predicted protein [Populus trichocarpa] | 9.0e-32 | 67% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9Z9
Fln msg: Distance to subject end: 232 aas, your sequence is shorter than subject: 79 - 429
Fln protein:
Q
Protein Length:
80
Fln nts:
C
Fln Alignment:
AllPine_b_c15892___QALDFVVFQASKYGVRLILSLVNNYVSFGGKAQYVQWARNAGQNL-NSEDDFFTDPTVKGYYKNHVKTVLTRVNSITGV
D5A9Z9________________RALDFVIVEARRNGLRLIFSLVNNLNAYGGKVQYVEWAHAAGINVGSSNDSFFSDPTIRGYYKEYVKSILVRKNSISGV
![]() |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
176 | 33 | 66 | 0.997467 | ||
180 | 66 | 33 | 0.997461 | ||
195 | 66 | 33 | 0.997476 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain