UniGene Name: sp_v3.0_unigene186262
Length: 239 nt
![]() |
---|
>sp_v3.0_unigene186262
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phospholipase D n=1 Tax=Populus trichocarpa RepID=B9GKQ7_POPTR | - | - | 5.0e-24 | 68% |
FL-Next | sp=Phospholipase D; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 54% |
Sma3 | Phospholipase d beta, putative | - | - | 1.345e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Phospholipase D. | EC:3.1.4.4 | - | 1.47e-39 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Glycerophospholipid metabolism | 00564 | 1.47e-39 | % | |
Sma3 | Ether lipid metabolism | 00565 | 1.47e-39 | % | |
Sma3 | Metabolic pathways | 01100 | 1.47e-39 | % |
Source | Gene names |
---|---|
Sma3 | A_IG005I10.13; At1g52570; At2g42010; At4g00240; At4g11830; At4g11840; At4g11850; F5I10.13; F6D8.21; GSVIVT00001073001; GSVIVT00007835001; GSVIVT00012363001; GSVIVT00026323001; GSVIVT00035483001; LOC_Os03g02740; LOC_Os03g62410; LOC_Os10g38060; OJ1263H11.7; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | cytoplasmic vesicle | GO:0031410 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | phospholipase D activity | GO:0004630 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | NAPE-specific phospholipase D activity | GO:0070290 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | abscisic acid mediated signaling pathway | GO:0009738 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | defense response to bacterium, incompatible interaction | GO:0009816 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | lipid catabolic process | GO:0016042 | Biological Process | 0.0 | - |
Sma3 | phosphatidylcholine metabolic process | GO:0046470 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | C2 calcium-dependent membrane targeting | IPR000008 | - | 0.0 | - |
Sma3 | Phospholipase D/Transphosphatidylase | IPR001736 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase active site | IPR006650 | - | 0.0 | - |
Sma3 | Phospholipase D, plant | IPR011402 | - | 0.0 | - |
Sma3 | Phospholipase D | IPR015679 | - | 0.0 | - |
Sma3 | C2 membrane targeting protein | IPR018029 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G00240.1 | PLDBETA2 phospholipase D beta 2 chr4:106380-110718 REVERSE LENGTH=927 | 8.0e-29 | 69% |
RefSeq | Arabidopsis thaliana | NP_567160.1 | phospholipase D beta 2 [Arabidopsis thaliana] | 1.0e-28 | 69% |
RefSeq | Populus trichocarpa | XP_002299568.1 | predicted protein [Populus trichocarpa] | 4.0e-30 | 68% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ49
Fln msg: Distance to subject end: 160 aas, your sequence is shorter than subject: 79 - 861
Fln protein:
W
Protein Length:
80
Fln nts:
G
Fln Alignment:
AllPine_b_c15564___WPEGIPTSIAMQRILYWQGQTMQMMYETIFKALEEVGLEKTYHPQDYLNFFCLGNREVRDNNEAPSKSAVPENTPHVRA
B8LQ49________________WPEGNPTGASVQEILFWQSQTMEMMYGIIAEALKDAGLADSQHPQDYLNFYCLGNREPKDGREPPPTNSPAENSPQGQA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain