UniGene Name: sp_v3.0_unigene185845
Length: 245 nt
![]() |
---|
>sp_v3.0_unigene185845
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Strong similarity to F22O13.22 gi|3063460 myosin homolog from A. thaliana BAC gb|AC003981 [Arabidopsis thaliana] | - | - | 3.0e-19 | 56% |
FL-Next | tr=Myosin XI; Marchantia polymorpha (Liverwort) (Marchantia aquatica). | - | - | 0.0 | 73% |
Sma3 | Myosin XI, putative | - | - | 9.796e-13 | - |
Source | Gene names |
---|---|
Sma3 | 41C02.1; At1g17580; At2g31900; At4g28710; At5g20470; At5g20490; At5g43900; F16A16.180; GSVIVT00003703001; GSVIVT00007440001; GSVIVT00016505001; GSVIVT00027091001; GSVIVT00027094001; GSVIVT00028463001; GSVIVT00032285001; GSVIVT00034148001; LOC_Os03g48140; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromosome | GO:0005694 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | myosin complex | GO:0016459 | Cellular Component | 0.0 | - |
Sma3 | motor activity | GO:0003774 | Molecular Function | 0.0 | - |
Sma3 | actin binding | GO:0003779 | Molecular Function | 0.0 | - |
Sma3 | DNA topoisomerase type I activity | GO:0003917 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | signal transducer activity | GO:0004871 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | actin filament binding | GO:0051015 | Molecular Function | 0.0 | - |
Sma3 | DNA topological change | GO:0006265 | Biological Process | 0.0 | - |
Sma3 | DNA unwinding involved in replication | GO:0006268 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | signal transduction | GO:0007165 | Biological Process | 0.0 | - |
Sma3 | actin filament-based movement | GO:0030048 | Biological Process | 0.0 | - |
Sma3 | keratinization | GO:0031424 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G54560.1 | XIE, ATXIE Myosin family protein with Dil domain chr1:20371649-20379745 REVERSE LENGTH=1529 | 3.0e-24 | 69% |
RefSeq | Arabidopsis thaliana | NP_175858.1 | Myosin family protein with Dil domain [Arabidopsis thaliana] | 4.0e-24 | 69% |
RefSeq | Populus trichocarpa | XP_002329057.1 | predicted protein [Populus trichocarpa] | 6.0e-25 | 74% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: tr_plants
Fln subject: H3JRT9
Fln msg: STOP codon was not found. Distance to subject end: 10 aas, your sequence is shorter than subject: 81 - 1536
Fln protein:
I
Protein Length:
82
Fln nts:
C
Fln Alignment:
AllPine_b_c14216___IQQIYRISTMFWDDKYGTHSVSPDVIAQLRTMMTE-XXXXXXXXXXXXXXXXXPFTVDDISKSVQDMNLSDVDPPPLLRQNS
H3JRT9________________VQQLYRISTMYWDDKYGTHSVSPEVIANMRVLMTEDSNSAVSNSFLLDDDSSIPFTVDDISKSMSDIDLSDVDAPPLLRDNA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain