UniGene Name: sp_v3.0_unigene185581
Length: 188 nt
![]() |
---|
>sp_v3.0_unigene185581
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | RecName: Full=Poly [ADP-ribose] polymerase 1; Short=PARP-1; AltName: Full=NAD(+) ADP-ribosyltransferase 1; Short=ADPRT-1; AltName: Full=Poly[ADP-ribose] synthase 1 gb|AAC79704.1| poly(ADP)-ribose polymerase [Zea mays] | - | - | 2.0e-18 | 62% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | Poly[ADP-ribose] synthetase 1 | - | - | 5.993e-13 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:2.4.2.3- | - | 1.318e-10 | - |
Source | Gene names |
---|---|
Sma3 | At2g31320; F16D14.16; GSVIVT00007500001; LOC_Os07g23110; OSJNBa0077F02.113; Os07g0413700; OsI_25738; OsJ_23951; PARP1; PHYPADRAFT_188096; POPTRDRAFT_830081; RCOM_0993250; VITISV_037618; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | NAD+ ADP-ribosyltransferase activity | GO:0003950 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
Sma3 | protein ADP-ribosylation | GO:0006471 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | response to abiotic stimulus | GO:0009628 | Biological Process | 0.0 | - |
Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | BRCT domain | IPR001357 | - | 0.0 | - |
Sma3 | Zinc finger, PARP-type | IPR001510 | - | 0.0 | - |
Sma3 | DNA-binding SAP | IPR003034 | - | 0.0 | - |
Sma3 | Poly(ADP-ribose) polymerase, regulatory domain | IPR004102 | - | 0.0 | - |
Sma3 | NAD+ ADP-ribosyltransferase | IPR008288 | - | 0.0 | - |
Sma3 | WGR domain | IPR008893 | - | 0.0 | - |
Sma3 | Poly(ADP-ribose) polymerase, catalytic domain | IPR012317 | - | 0.0 | - |
Sma3 | PADR1 | IPR012982 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G31320.1 | PARP2, ATPARP2 poly(ADP-ribose) polymerase 2 chr2:13354046-13359578 REVERSE LENGTH=983 | 7.0e-23 | 61% |
RefSeq | Populus trichocarpa | XP_002302058.1 | predicted protein [Populus trichocarpa] | 9.0e-26 | 67% |
![]() |
---|
Fln status: Putative N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AA06
Fln msg: Distance to subject end: 323 aas, atg_distance in limit (1-15): atg_distance = 11, W2: There is no M at the beginning, your sequence is shorter than subject: 62 - 395
Fln protein:
W
Protein Length:
63
Fln nts:
_
Fln Alignment:
AllPine_b_c13461___WKIEYAKSSRSTCKTCKNTIEKDVLRIAKMIAATQFDGFMPMWNHAACILKKKGQFKTLNDV
D5AA06________________WKVEYAKSSRSSCKTCKQPIGKGSLRIAKMVAARQFEGVMPIWNHVECILKYPGQFRTIDDV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain