|
||||||
|
UniGene Name: sp_v3.0_unigene185318
Length: 231 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene185318
T |
|
Ace file of the UniGene sp_v3.0_unigene185318 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Amino acid dehydrogenase family protein [Arabidopsis thaliana] gb|AAC13627.1| F6N23.26 gene product [Arabidopsis thaliana] emb|CAB80871.1| putative tetrahydrofolate synthase [Arabidopsis thaliana] gb|AAL24426.1| Unknown protein [Arabidopsis thaliana] gb|A | - | - | 4.0e-31 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 92% |
| Sma3 | Tetrahydrofolate dehydrogenase/cyclohydrolase | - | - | 6.452e-12 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methylenetetrahydrofolate dehydrogenase (NADP(+)). | EC:1.5.1.5 | - | 4.18e-14 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | One carbon pool by folate | 00670 | 4.18e-14 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 4.18e-14 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.18e-14 | % | |
| Sma3 | Methenyltetrahydrofolate cyclohydrolase. | EC:3.5.4.9 | - | 2.845e-22 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | One carbon pool by folate | 00670 | 2.845e-22 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 2.845e-22 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.845e-22 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT4g00600; AT4g00620; At2g38660; At3g12290; At4g00600; At4g00620; At4g00620/F6N23.26; CHLREDRAFT_114203; CHLREDRAFT_194856; CHLREDRAFT_206121; F28J15.8; F6N23.26; F6N23.28; GSVIVT00004384001; GSVIVT00010817001; GSVIVT00026785001; GSVIVT00027962001; GSVIVT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | methenyltetrahydrofolate cyclohydrolase activity | GO:0004477 | Molecular Function | 0.0 | - |
| Sma3 | methylenetetrahydrofolate dehydrogenase (NADP+) activity | GO:0004488 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | ATP-dependent helicase activity | GO:0008026 | Molecular Function | 0.0 | - |
| Sma3 | hydrolase activity | GO:0016787 | Molecular Function | 0.0 | - |
| Sma3 | folic acid-containing compound biosynthetic process | GO:0009396 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tetrahydrofolate dehydrogenase/cyclohydrolase | IPR000672 | - | 0.0 | - |
| Sma3 | Helicase, C-terminal | IPR001650 | - | 0.0 | - |
| Sma3 | DNA/RNA helicase, DEAD/DEAH box type, N-terminal | IPR011545 | - | 0.0 | - |
| Sma3 | Helicase, superfamily 1/2, ATP-binding domain | IPR014001 | - | 0.0 | - |
| Sma3 | IPR014021 | - | 0.0 | - | |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Aldehyde dehydrogenase, conserved site | IPR016160 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G00620.1 | Amino acid dehydrogenase family protein chr4:259265-260788 REVERSE LENGTH=360 | 8.99999e-40 | 85% |
| RefSeq | Arabidopsis thaliana | NP_191971.1 | Amino acid dehydrogenase family protein [Arabidopsis thaliana] | 1.0e-39 | 85% |
| RefSeq | Populus trichocarpa | XP_002302571.1 | tetrahydrofolate dehydrogenase/cyclohydrolase [Populus trichocarpa] | 2.0e-37 | 78% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NV85
Fln msg: Distance to subject end: 134 aas, your sequence is shorter than subject: 76 - 393
Fln protein:
M
Protein Length:
77
Fln nts:
T
Fln Alignment:
AllPine_b_c12673___MFNDDPSVHGVLIQLPLPRHICEENILNAVSIEKDVDGFHPLNIGRLAMQGREPLFVPCTPKGCIELLIRSGIDIV
A9NV85________________MFNDDPSVHGVLVQLPLPQHICEEKILNAVSIDKDVDGFHPLNIGRLAMQGREPLFVPCTPKGCIELLIRSGIDMM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
