SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene184472

Length: 341 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene184472
AGTTTGGTGAAGTGAAGGTAGCGGGCTTTGATTCTTGACGTATTTGCTCCCAAAGTCTCGTAGAAGAAAAAGAAATTCGAGAGACTGCAAGGCGAAGAAGCTGATCAAGATGAGCATCTGGAACTACGTTGTGACTGCTCACAAACCAACTAATGTGACTCATTCCTGCGTCGGCAACTTTACCAATCCACACGACATTAATCTCATCATAGCGAAATGTACCAGAATAGAGATTCATATTCTTGCTCCACAGGGTTTACAGCCAATGCTAGATGTACCAATCTACGGACGAATTGCAACACTGGAGCTCTTCCGACCTCATGGGGAGACACAGGATTATC

Ace file of the UniGene sp_v3.0_unigene184472 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	DNA repair protein xp-E, putative n=1 Tax=Ricinus communis RepID=B9SKT9_RICCO	-	-	5.0e-35	88%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	94%

Source	Gene names
Sma3	At4g05420; At4g21100; C6L9.100; CHLREDRAFT_133572; DDB1; DDB1A; DDB1B; F7J7.40; GSVIVT00028385001; MICPUCDRAFT_50560; MICPUN_97627; OSTLU_26305; Os05g0592400; OsI_02599; OsI_02601; OsI_21216; OsJ_19757; OsUV-DDB; Ot10g03450; P0663C08.8; PHYPADRAFT_101177;

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	CUL4 RING ubiquitin ligase complex	GO:0080008	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	RNA-directed DNA polymerase activity	GO:0003964	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	RNA-dependent DNA replication	GO:0006278	Biological Process	-
Sma3	DNA repair	GO:0006281	Biological Process	-
Sma3	red, far-red light phototransduction	GO:0009585	Biological Process	-
Sma3	embryo development ending in seed dormancy	GO:0009793	Biological Process	-
Sma3	red or far-red light signaling pathway	GO:0010017	Biological Process	-
Sma3	negative regulation of photomorphogenesis	GO:0010100	Biological Process	-
Sma3		GO:0016481	Biological Process	-
Sma3	modification-dependent protein catabolic process	GO:0019941	Biological Process	-
Sma3	cell redox homeostasis	GO:0045454	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Reverse transcriptase	IPR000477	-	-
Sma3	Aminotransferase, class I/classII	IPR004839	-	-
Sma3	Cleavage/polyadenylation specificity factor, A subunit, C-terminal	IPR004871	-	-
Sma3	Ureohydrolase	IPR006035	-	-
Sma3		IPR012335	-	-
Sma3	Thioredoxin domain	IPR013766	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 1	IPR015421	-	-
Sma3	Pyridoxal phosphate-dependent transferase, major region, subdomain 2	IPR015422	-	-
Sma3		IPR015706	-	-
Sma3		IPR017936	-	-
Sma3	Thioredoxin, conserved site	IPR017937	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT4G05420.1	DDB1A damaged DNA binding protein 1A chr4:2746288-2752663 FORWARD LENGTH=1088	8.00001e-42	85%
RefSeq	Arabidopsis thaliana	NP_001118940.1	DNA damage-binding protein 1a [Arabidopsis thaliana]	9.99967e-42	85%
RefSeq	Populus trichocarpa	XP_002300334.1	predicted protein [Populus trichocarpa]	3.00004e-41	85%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: B8LPM3

Fln msg: Distance to subject end: 394 aas, your sequence is shorter than subject: 77 - 471

Fln protein: MSIWNYVVTAHKPTNVTHSCVGNFTNPHDINLIIAKCTRIEIHILAPQGLQPMLDVPIYGRIATLELFRPHGETQDY

Protein Length: 78

Fln nts: AGTTTGGTGAAGTGAAGGTAGCGGGCTTTGATTCTTGACGTATTTGCTCCCAAAGTCTCGTAGAAGAAAAAGAAATTCGAGAGACTGCAAGGCGAAGAAGCTGATCAAG_-_ATGAGCATCTGGAACTACGTTGTGACTGCTCACAAACCAACTAATGTGACTCATTCCTGCGTCGGCAACTTTACCAATCCACACGACATTAATCTCATCATAGCGAAATGTACCAGAATAGAGATTCATATTCTTGCTCCACAGGGTTTACAGCCAATGCTAGATGTACCAATCTACGGACGAATTGCAACACTGGAGCTCTTCCGACCTCATGGGGAGACACAGGATTATC

Fln Alignment:

AllPine_b_c10056___MSIWNYVVTAHKPTNVTHSCVGNFTNPHDINLIIAKCT
B8LPM3________________MSIWNYVVTAHKPTNVTHSCVGNFTNPHDINLIIAPMT

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain