UniGene Name: sp_v3.0_unigene183091
Length: 227 nt
![]() |
---|
>sp_v3.0_unigene183091
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | transketolase [Nicotiana attenuata] | - | - | 8.0e-31 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
Sma3 | TK | - | - | 6.5e-23 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transketolase. | EC:2.2.1.1 | - | 4.614e-27 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Pentose phosphate pathway | 00030 | 4.614e-27 | % | |
Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 4.614e-27 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.614e-27 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 4.614e-27 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 4.614e-27 | % | |
Sma3 | Metabolic pathways | 01100 | 4.614e-27 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.614e-27 | % |
Source | Gene names |
---|---|
Sma3 | 134P10.11; AT3G60750; At2g45290; At3g60750; GSVIVT00026404001; GSVIVT00038435001; MICPUN_104852; OSIGBa0139I12.3; OSJNBa0072D08.7; Os04g0266900; Os06g0133800; OsI_15126; OsI_21507; OsJ_14067; OsJ_20020; P0001H02.3; P0679C08.41; PHYPADRAFT_107024; PHYPADRA |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | transketolase activity | GO:0004802 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | pentose-phosphate shunt, oxidative branch | GO:0009051 | Biological Process | 0.0 | - |
Sma3 | reductive pentose-phosphate cycle | GO:0019253 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, rhodopsin-like, 7TM | IPR000276 | - | 0.0 | - |
Sma3 | Transketolase, N-terminal | IPR005474 | - | 0.0 | - |
Sma3 | Transketolase-like, pyrimidine-binding domain | IPR005475 | - | 0.0 | - |
Sma3 | Transketolase, C-terminal | IPR005476 | - | 0.0 | - |
Sma3 | Transketolase, bacterial-like | IPR005478 | - | 0.0 | - |
Sma3 | Transketolase-like, C-terminal | IPR015941 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G45290.1 | Transketolase chr2:18672737-18675589 FORWARD LENGTH=741 | 4.0e-36 | 77% |
RefSeq | Arabidopsis thaliana | NP_566041.2 | Transketolase [Arabidopsis thaliana] | 5.0e-36 | 77% |
RefSeq | Populus trichocarpa | XP_002320056.1 | predicted protein [Populus trichocarpa] | 2.0e-38 | 82% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ72
Fln msg: Distance to subject end: 337 aas, your sequence is shorter than subject: 75 - 751
Fln protein:
S
Protein Length:
76
Fln nts:
T
Fln Alignment:
AllPine_b_c3118___SPNKANSYSVHGSALGAKEVDATRLFLGWPHPPFHVPEEVKSHWSRHVARGAAFEAEWSSKFAEHEKKYPEEAAE
C0PQ72________________SPNKANSYSVHGSALGAKEVDATRQNLGWPHPPFHVPEEVKSHWSRHAARGASFEAEWSSKLAEHEKKYPEEAAE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain