UniGene Name: sp_v3.0_unigene168344
Length: 190 nt
UniGene Fasta |
---|
>sp_v3.0_unigene168344
A |
Ace file of the UniGene sp_v3.0_unigene168344 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative S-receptor kinase [Oryza sativa Japonica Group] | - | - | 4.0e-13 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Putative S-domain receptor-like protein kinase | - | - | 1.969e-06 | - |
Source | Gene names |
---|---|
Sma3 | B1099D03.51; GSVIVT00029223001; GSVIVT00032659001; H0525E10.2; H0525E10.6; H0525E10.8; OSIGBa0148I18.4; OSJNBa0028I23.11; OSJNBa0028I23.12; OSJNBa0028I23.17; OSJNBa0028I23.8; OSJNBa0094O15.4; OSJNBb0108J11.18; Os01g0222800; Os01g0890600; Os04g0103500; Os0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like domain | IPR000742 | - | 0.0 | - |
Sma3 | S-locus glycoprotein | IPR000858 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | IPR001899 | - | 0.0 | - | |
Sma3 | Apple-like | IPR003609 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | PAN-2 domain | IPR013227 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G19130.1 | S-locus lectin protein kinase family protein chr2:8293789-8296275 FORWARD LENGTH=828 | 1.0e-15 | 52% |
RefSeq | Arabidopsis thaliana | NP_179503.1 | S-locus lectin protein kinase-like protein [Arabidopsis thaliana] | 2.0e-15 | 52% |
RefSeq | Populus trichocarpa | XP_002319938.1 | predicted protein [Populus trichocarpa] | 2.0e-17 | 56% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 216 aas, your sequence is shorter than subject: 63 - 431
Fln protein:
K
Protein Length:
64
Fln nts:
A
Fln Alignment:
HIF1XHV03GAVW0___KF*VEVTIICMIHHLNLV*TKGFCAQGEHRLLVYEYIPNGSLDTHLFSANTQLDWKRRYQIAL
A9NM60________________EFCAEIGTTSSINHSNLVRLHGICVEGQHRILVYEFMANGSLDRWLFDSDKWLDWKTRYSIAL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain