UniGene Name: sp_v3.0_unigene168343
Length: 117 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene168343
T |
Ace file of the UniGene sp_v3.0_unigene168343
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Lectin receptor-type kinase n=2 Tax=Triticeae RepID=B8XSN7_AEGTA | - | - | 1.0e-10 | 78% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 97% |
| Sma3 | Kinase, putative | - | - | 1.35e-15 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cyclin-dependent kinase. | EC:2.7.11.22 | - | 4.617e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g02410; AT4g02420; At2g37710; At4g02410; At4g02420; GSVIVT00001297001; GSVIVT00001298001; GSVIVT00001301001; GSVIVT00001302001; GSVIVT00005974001; GSVIVT00018441001; GSVIVT00018594001; GSVIVT00021359001; GSVIVT00021360001; GSVIVT00024271001; GSVIVT0002 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | cell surface | GO:0009986 | Cellular Component | 0.0 | - |
| Sma3 | protein kinase activity | GO:0004672 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
| Sma3 | Legume lectin domain | IPR001220 | - | 0.0 | - |
| Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
| Sma3 | Zinc finger, RING-type | IPR001841 | - | 0.0 | - |
| Sma3 | IPR001899 | - | 0.0 | - | |
| Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
| Sma3 | Serine/threonine- / dual-specificity protein kinase, catalytic domain | IPR002290 | - | 0.0 | - |
| Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
| Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
| Sma3 | Concanavalin A-like lectin/glucanase, subgroup | IPR013320 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | IPR017442 | - | 0.0 | - | |
| Sma3 | Zinc finger, C3HC4 RING-type | IPR018957 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G70110.1 | Concanavalin A-like lectin protein kinase family protein chr1:26406238-26408323 REVERSE LENGTH=666 | 8.0e-13 | 68% |
| RefSeq | Arabidopsis thaliana | NP_177168.1 | concanavalin A-like lectin protein kinase [Arabidopsis thaliana] | 1.0e-12 | 68% |
| RefSeq | Populus trichocarpa | XP_002328149.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-13 | 70% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ6
Fln msg: Distance to subject end: 157 aas, your sequence is shorter than subject: 38 - 704
Fln protein:
H
Protein Length:
39
Fln nts:
T
Fln Alignment:
HIF1XHV03GLYBY___HVVGTLGYIAPELIHTGKATPSSDVFSFGVLLLEVACG
B8LLJ6________________HVVGTLGYIAPELIHTGKATPSSDVFSFGVLLLEVTCG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta