UniGene Name: sp_v3.0_unigene168306
Length: 233 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene168306
A |
Ace file of the UniGene sp_v3.0_unigene168306
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Cycas revoluta RepID=B3U1U9_CYCRE | - | - | 4.0e-27 | 73% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 67% |
| Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g47580; At2g02980; At2g22070; At3g26782; At3g49170; At3g61170; At3g62890; At4g02750; At4g33170; B1032F05.19; EMB2261; F16N3.14; F26K9_320; F2K15.30; F4I10.100; GSVIVT00000887001; GSVIVT00001706001; GSVIVT00002068001; GSVIVT00003383001; GSVIVT0000406800 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G33170.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:15995701-15998673 REVERSE LENGTH=990 | 9.0e-28 | 63% |
| RefSeq | Arabidopsis thaliana | NP_195043.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 1.0e-27 | 63% |
| RefSeq | Populus trichocarpa | XP_002326908.1 | predicted protein [Populus trichocarpa] | 2.0e-29 | 60% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 32 aas, your sequence is shorter than subject: 77 - 246
Fln protein:
N
Protein Length:
78
Fln nts:
A
Fln Alignment:
HIF1XHV03GA797___IYATLERLLAQIKAAGYMSNTQFVLHDMEEEQKEHALFYHSEKLAVTFGLLNTSPGTPIRIIKNLRVCGDCHNAIR
D5AAE0________________IYSTLEELARQMEAAGYVPDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta