UniGene Name: sp_v3.0_unigene168284
Length: 131 nt
UniGene Fasta |
---|
>sp_v3.0_unigene168284
G |
Ace file of the UniGene sp_v3.0_unigene168284 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9SHZ8.1|PP168_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g22070 gb|AAD25817.1| hypothetical protein [Arabidopsis thaliana] gb|AEC07259.1| pentatricopeptide repe | - | - | 2.0e-11 | 75% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
Source | Gene names |
---|---|
Sma3 | At2g22070; At3g03580; At3g12770; At3g24000; At3g26782; At4g30700; B1032F05.19; DYW9; F14O13.19; GSVIVT00000673001; GSVIVT00003060001; GSVIVT00006516001; GSVIVT00007922001; GSVIVT00008013001; GSVIVT00010543001; GSVIVT00011403001; GSVIVT00013634001; GSVIVT0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G22070.1 | pentatricopeptide (PPR) repeat-containing protein chr2:9383602-9385962 FORWARD LENGTH=786 | 5.0e-16 | 75% |
RefSeq | Arabidopsis thaliana | NP_179798.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 6.0e-16 | 75% |
RefSeq | Populus trichocarpa | XP_002302824.1 | predicted protein [Populus trichocarpa] | 1.0e-15 | 75% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAH8
Fln msg: your sequence is shorter than subject: 38 - 210
Fln protein:
H
Protein Length:
39
Fln nts:
G
Fln Alignment:
HIF1XHV03G6H3T___HTALKFICKIVGREIVVRDANRFHHYKDGQCSCQDYW
D5AAH8________________HTATKFISKIAGREIVVRDANRFHHFKDGLCSCGDYW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain