UniGene Name: sp_v3.0_unigene168253
Length: 174 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene168253
A |
Ace file of the UniGene sp_v3.0_unigene168253
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cell division protein [Guillardia theta] sp|O78516.1|FTSH_GUITH RecName: Full=ATP-dependent zinc metalloprotease FtsH gb|AAC35738.1| hypothetical chloroplast RF25 [Guillardia theta] | - | - | 9.0e-16 | 85% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 81% |
| Sma3 | Cell division protease ftsH homolog | - | - | 1.872e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Hydrolases, Acting on peptide bonds (peptide hydrolases), Metalloendopeptidases. | EC:3.4.24.- | - | 0.0 | - |
| Sma3 | Microtubule-severing ATPase. | EC:3.6.4.3 | - | 2.488e-10 | - |
| Source | Gene names |
|---|---|
| Sma3 | AAA; AT2G30950; AT5G42270; At1g06430; At1g50250; At2g30950; At3g47060; At5g15250; At5g42270; At5g58870; CHLREDRAFT_55270; CHLREDRAFT_58334; F12K11.22; F12K11_24; F13I12.110; F14I3.14; F7F1.16; F8M21.140; FTSH; FTSH1; FTSH2; FTSH5; FTSH6; FTSH7; FTSH8; FTS |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | intracellular | GO:0005622 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | thylakoid lumen | GO:0031977 | Cellular Component | 0.0 | - |
| Sma3 | ATP-dependent peptidase activity | GO:0004176 | Molecular Function | 0.0 | - |
| Sma3 | metalloendopeptidase activity | GO:0004222 | Molecular Function | 0.0 | - |
| Sma3 | serine-type endopeptidase activity | GO:0004252 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | nucleoside-triphosphatase activity | GO:0017111 | Molecular Function | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | cell cycle | GO:0007049 | Biological Process | 0.0 | - |
| Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
| Sma3 | thylakoid membrane organization | GO:0010027 | Biological Process | 0.0 | - |
| Sma3 | photoinhibition | GO:0010205 | Biological Process | 0.0 | - |
| Sma3 | photosystem II repair | GO:0010206 | Biological Process | 0.0 | - |
| Sma3 | PSII associated light-harvesting complex II catabolic process | GO:0010304 | Biological Process | 0.0 | - |
| Sma3 | protein catabolic process | GO:0030163 | Biological Process | 0.0 | - |
| Sma3 | regulation of apoptotic process | GO:0042981 | Biological Process | 0.0 | - |
| Sma3 | cell division | GO:0051301 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ribosomal protein S7 | IPR000235 | - | 0.0 | - |
| Sma3 | Peptidase M41 | IPR000642 | - | 0.0 | - |
| Sma3 | Caspase Recruitment | IPR001315 | - | 0.0 | - |
| Sma3 | IPR001984 | - | 0.0 | - | |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | AAA+ ATPase domain | IPR003593 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
| Sma3 | ATPase, AAA-type, conserved site | IPR003960 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Peptidase, FtsH | IPR005936 | - | 0.0 | - |
| Sma3 | Twin-arginine translocation pathway, signal sequence | IPR006311 | - | 0.0 | - |
| Sma3 | Peptidase M41, FtsH extracellular | IPR011546 | - | 0.0 | - |
| Sma3 | IPR017909 | - | 0.0 | - | |
| Sma3 | Peptidase S26A, signal peptidase I, serine active site | IPR019756 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G30950.1 | VAR2, FTSH2 FtsH extracellular protease family chr2:13174692-13177064 FORWARD LENGTH=695 | 4.0e-20 | 81% |
| RefSeq | Arabidopsis thaliana | NP_850156.1 | cell division protease ftsH-2 [Arabidopsis thaliana] | 5.0e-20 | 81% |
| RefSeq | Populus trichocarpa | XP_002332995.1 | predicted protein [Populus trichocarpa] | 3.0e-21 | 83% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQ75
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 264 aas, your sequence is shorter than subject: 52 - 695
Fln protein:
V
Protein Length:
53
Fln nts:
A
Fln Alignment:
HIF1XHV03G6CW5___VIVIAATNRVDVLDAALLRPGRFDRQVTVDVPDVSGRKAILKVHASNKK
C0PQ75________________IIVIAATNRADILDAALLRPGRFDRQVSVDVPDVKGRTEILKVHGGNKK

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta