|
||||||
|
UniGene Name: sp_v3.0_unigene168216
Length: 174 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene168216
C |
|
Ace file of the UniGene sp_v3.0_unigene168216
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Pellia epiphylla RepID=B3U1Q7_9MARC | - | - | 1.0e-20 | 77% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
| Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g20230; At1g25360; At1g47580; At2g27610; At3g03580; At3g57430; At3g62890; At4g14050; At4g30700; At4g33170; At4g37380; DYW9; F10A12.28; F15K20.29; F16N3.14; F26K9_320; F4F7.25; F4I10.100; F6G17.30; FCAALL.80; GSVIVT00002188001; GSVIVT00005426001; GSVIVT |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
| Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G57430.1 | OTP84 Tetratricopeptide repeat (TPR)-like superfamily protein chr3:21255731-21258403 REVERSE LENGTH=890 | 7.0e-23 | 67% |
| RefSeq | Arabidopsis thaliana | NP_191302.2 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 9.0e-23 | 67% |
| RefSeq | Populus trichocarpa | XP_002299387.1 | predicted protein [Populus trichocarpa] | 5.0e-24 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: Distance to subject end: 32 aas, your sequence is shorter than subject: 58 - 246
Fln protein:
P
Protein Length:
59
Fln nts:
C
Fln Alignment:
HIF1XHV03FR7LD___PDTNFVLHDIEEKEKEDVLCGHSEKLAIAFGLMKTKPGTPLRIIKNLRICGDCHTSTK
D5AAE0________________PDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
