UniGene Name: sp_v3.0_unigene168189
Length: 163 nt
UniGene Fasta |
---|
>sp_v3.0_unigene168189
T |
Ace file of the UniGene sp_v3.0_unigene168189 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Adenylosuccinate synthetase 2, chloroplastic n=2 Tax=Oryza sativa RepID=PURA2_ORYSJ | - | - | 3.0e-17 | 79% |
FL-Next | sp=Adenylosuccinate synthetase 2, chloroplastic; Oryza sativa subsp. japonica (Rice). | - | - | 0.0 | 79% |
Sma3 | Adenylosuccinate synthetase | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Adenylosuccinate synthase. | EC:6.3.4.4 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Purine metabolism | 00230 | 0.0 | % | |
Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | 7.PEPPER.5; 7.POTATO.5; 7P.PEPPER.6; At3g57610; CHLREDRAFT_196727; F15B8.200; GSVIVT00025551001; LOC_Os03g07840; LOC_Os03g49220; MICPUCDRAFT_47447; MICPUN_97107; OSJNBb0017F17.14; OSTLU_19549; Os03g0174500; Os03g0699300; OsI_10220; OsI_13153; OsJ_09613; O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | adenylosuccinate synthase activity | GO:0004019 | Molecular Function | 0.0 | - |
Sma3 | GTP binding | GO:0005525 | Molecular Function | 0.0 | - |
Sma3 | purine nucleotide biosynthetic process | GO:0006164 | Biological Process | 0.0 | - |
Sma3 | AMP biosynthetic process | GO:0006167 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Adenylosuccinate synthetase | IPR001114 | - | 0.0 | - |
Sma3 | Exostosin-like | IPR004263 | - | 0.0 | - |
Sma3 | Epidermal growth factor-like | IPR006210 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | EGF, extracellular | IPR013111 | - | 0.0 | - |
Sma3 | Adenylosuccinate synthase, active site | IPR018220 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G57610.1 | ADSS adenylosuccinate synthase chr3:21334519-21336603 REVERSE LENGTH=490 | 8.0e-22 | 77% |
RefSeq | Arabidopsis thaliana | NP_191320.1 | adenylosuccinate synthetase [Arabidopsis thaliana] | 1.0e-21 | 77% |
RefSeq | Populus trichocarpa | XP_002323461.1 | predicted protein [Populus trichocarpa] | 5.0e-22 | 77% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q851S8
Fln msg: Distance to subject end: 333 aas, your sequence is shorter than subject: 54 - 489
Fln protein:
A
Protein Length:
55
Fln nts:
T
Fln Alignment:
HIF1XHV03GR0CP___AGHTINNSEGKKFSLHLVPSGIVNEKALCVFENGAVVHLPRLFEEIDELESNGV
Q851S8________________AGHTIYNSEGKKFSLHLVPSGILNEKTMCVVGNGAVVHLPGFFKEIDGLESNGI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain