UniGene Name: sp_v3.0_unigene168177
Length: 228 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene168177
C |
Ace file of the UniGene sp_v3.0_unigene168177 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Putative polyprotein n=1 Tax=Oryza sativa Japonica Group RepID=Q75HH6_ORYSJ | - | - | 4.0e-17 | 56% |
FL-Next | sp=Uncharacterized mitochondrial protein AtMg00860; Arabidopsis thaliana (Mouse-ear cress). Mitochondrion. | - | - | 0.0 | 42% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 2.14399e-43 | - |
Source | Gene names |
---|---|
Sma3 | B1168G10.5; B1234D02.1; H0124E07.7; H0207B04.5; H0409D10.7; H0425E08.11; H0502B11.9; H0512B01.1; H0522A01.6; H0616A11.3; H0807C06-H0308C08.6; H0820C10.2; LOC_Os03g21350; LOC_Os03g23110; LOC_Os03g26760; LOC_Os03g29790; LOC_Os03g34190; LOC_Os03g41960; LOC_O |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | O-methyltransferase, family 2 | IPR001077 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Carbohydrate/puine kinase, PfkB, conserved site | IPR002173 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
Sma3 | Plant methyltransferase dimerisation | IPR012967 | - | 0.0 | - |
Sma3 | Reverse transcriptase, RNA-dependent DNA polymerase | IPR013103 | - | 0.0 | - |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: P92523
Fln msg: Distance to subject end: 21 aas, your sequence is shorter than subject: 75 - 158
Fln protein:
H
Protein Length:
76
Fln nts:
C
Fln Alignment:
HIF1XHV03GRU0M___EVRSFMGLVSYYRRFVEGFSKIANPITTL*RKGVKYEWTEECHRAFSKLKRLLTSASILQVSDMDKDFV
P92523________________ELRGFLGLTGYYRRFVKNYGKIVRPLTELLKKN-SLKWTEMAALAFKALKGAVTTLPVLALPDLKLPFV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain