UniGene Name: sp_v3.0_unigene168159
Length: 144 nt
![]() |
---|
>sp_v3.0_unigene168159
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | asparaginyl-tRNA synthetase, putative [Brassica oleracea] | - | - | 1.0e-16 | 91% |
FL-Next | sp=Asparagine--tRNA ligase, chloroplastic/mitochondrial; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 91% |
Sma3 | Asparaginyl-tRNA synthetase, cytoplasmic 3 | - | - | 1.82e-07 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Asparagine--tRNA ligase. | EC:6.1.1.22 | - | 2.556e-13 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Aminoacyl-tRNA biosynthesis | 00970 | 2.556e-13 | % |
Source | Gene names |
---|---|
Sma3 | 31.t00024; At1g70980; At4g17300; At5g56680; B1039D07.28; B1045D11.6; CHLREDRAFT_117306; EMB2755; F15H11.17; GSVIVT00008056001; GSVIVT00016614001; MICPUCDRAFT_51256; MICPUCDRAFT_63451; MICPUN_59321; MICPUN_63150; MIK19.13; NS1; OJ1753_E03.117; OSTLU_19266; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity | GO:0004365 | Molecular Function | 0.0 | - |
Sma3 | aminoacyl-tRNA ligase activity | GO:0004812 | Molecular Function | 0.0 | - |
Sma3 | aspartate-tRNA ligase activity | GO:0004815 | Molecular Function | 0.0 | - |
Sma3 | asparagine-tRNA ligase activity | GO:0004816 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
Sma3 | glucose metabolic process | GO:0006006 | Biological Process | 0.0 | - |
Sma3 | tRNA aminoacylation for protein translation | GO:0006418 | Biological Process | 0.0 | - |
Sma3 | asparaginyl-tRNA aminoacylation | GO:0006421 | Biological Process | 0.0 | - |
Sma3 | aspartyl-tRNA aminoacylation | GO:0006422 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | WHEP-TRS | IPR000738 | - | 0.0 | - |
Sma3 | Aspartyl/Asparaginyl-tRNA synthetase, class IIb | IPR002312 | - | 0.0 | - |
Sma3 | 2-oxo acid dehydrogenase, lipoyl-binding site | IPR003016 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class II (D/K/N) | IPR004364 | - | 0.0 | - |
Sma3 | Nucleic acid binding, OB-fold, tRNA/helicase-type | IPR004365 | - | 0.0 | - |
Sma3 | Asparaginyl-tRNA synthetase, class IIb | IPR004522 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class II | IPR006195 | - | 0.0 | - |
Sma3 | Nucleic acid-binding, OB-fold | IPR012340 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Aminoacyl-tRNA synthetase, class II (D/K/N)-like | IPR018150 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G17300.1 | NS1, OVA8, ATNS1 Class II aminoacyl-tRNA and biotin synthetases superfamily protein chr4:9681558-9684833 FORWARD LENGTH=567 | 3.0e-22 | 91% |
RefSeq | Arabidopsis thaliana | NP_193462.1 | asparaginyl-tRNA synthetase [Arabidopsis thaliana] | 4.0e-22 | 91% |
RefSeq | Populus trichocarpa | XP_002309798.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 91% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: O48593
Fln msg: Distance to subject end: 85 aas, your sequence is shorter than subject: 47 - 567
Fln protein:
C
Protein Length:
48
Fln nts:
A
Fln Alignment:
HIF1XHV03GH6QU___DLQSEHERYITEEAFSGSPVIIRDYPKDIKAFYMRENADGKTVAAM
O48593________________DLQSEHERYITEEAFGGRPVIIRDYPKEIKAFYMRENDDGKTVAAM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain