|
||||||
|
UniGene Name: sp_v3.0_unigene168045
Length: 196 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene168045
C |
|
Ace file of the UniGene sp_v3.0_unigene168045
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | wall-associated kinase 4-like [Oryza sativa Japonica Group] dbj|BAG94677.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 4.0e-17 | 63% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 52% |
| Sma3 | Wall-associated kinase, putative | - | - | 4.118e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 3.038e-06 | - |
| Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 2.325e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g18390; At1g25390; At1g66880; At2g23450; At3g53840; At5g02070; At5g38210; At5g66790; B1250G12.24; F15H18.11; F15H18.25; F26B6.10; F2J7.14; F4N21.1; F5K20_140; G9-5; GSVIVT00000553001; GSVIVT00001183001; GSVIVT00001786001; GSVIVT00001787001; GSVIVT00001 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G25390.1 | Protein kinase superfamily protein chr1:8906640-8908800 REVERSE LENGTH=629 | 4.0e-21 | 63% |
| RefSeq | Arabidopsis thaliana | NP_173910.1 | protein kinase-like protein [Arabidopsis thaliana] | 5.0e-21 | 63% |
| RefSeq | Populus trichocarpa | XP_002332861.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-22 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ93
Fln msg: Distance to subject end: 152 aas, your sequence is shorter than subject: 65 - 350
Fln protein:
G
Protein Length:
66
Fln nts:
C
Fln Alignment:
HIF1XHV03GZK12___VLAWDTRLNIAIQTAQALAFLHSHDPP-LFHRDVKSSNILLDEDFNVKVADFGLCRLMPDDATHI
B8LQ93________________LLDWSRRMNIAIGSAEGLAYLHHHATPHIIHRDIKASNVLLDSDFKAQVADFGFAKLIPEGETHV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
