UniGene Name: sp_v3.0_unigene168013
Length: 206 nt
UniGene Fasta |
---|
>sp_v3.0_unigene168013
A |
Ace file of the UniGene sp_v3.0_unigene168013 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Glutamate receptor (Fragment) n=1 Tax=Populus trichocarpa RepID=B9H5K3_POPTR | - | - | 4.0e-21 | 67% |
FL-Next | sp=Glutamate receptor 3.3; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 66% |
Sma3 | Glutamate-gated kainate-type ion channel receptor subunit GluR5 | - | - | 1.042e-16 | - |
Source | Gene names |
---|---|
Sma3 | ACL1; At1g05200; At1g42540; At2g17260; At2g32400; At3g51480; At4g35290; F23E12.150; F26O13.120; GLR2; GLR3.1; GLR3.2; GLR3.3; GLR3.4; GLR3.6; GLR3.7; GLR4; GLR5; GLUR2; GLUR3; GSVIVT00002906001; GSVIVT00019331001; GSVIVT00026034001; GSVIVT00036282001; Glu |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | G-protein coupled receptor activity | GO:0004930 | Molecular Function | 0.0 | - |
Sma3 | G-protein coupled GABA receptor activity | GO:0004965 | Molecular Function | 0.0 | - |
Sma3 | ionotropic glutamate receptor activity | GO:0004970 | Molecular Function | 0.0 | - |
Sma3 | extracellular-glutamate-gated ion channel activity | GO:0005234 | Molecular Function | 0.0 | - |
Sma3 | ion transport | GO:0006811 | Biological Process | 0.0 | - |
Sma3 | G-protein coupled receptor signaling pathway | GO:0007186 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GPCR, family 3 | IPR000337 | - | 0.0 | - |
Sma3 | Ionotropic glutamate receptor | IPR001320 | - | 0.0 | - |
Sma3 | Extracellular ligand-binding receptor | IPR001828 | - | 0.0 | - |
Sma3 | GPCR, family 3, gamma-aminobutyric acid receptor, type B | IPR002455 | - | 0.0 | - |
Sma3 | Zinc finger, C2H2 | IPR007087 | - | 0.0 | - |
Sma3 | IPR015683 | - | 0.0 | - | |
Sma3 | Ionotropic glutamate receptor, plant | IPR017103 | - | 0.0 | - |
Sma3 | HTH domain AraC-type, conserved site | IPR018062 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G42540.1 | ATGLR3.3, GLR3.3 glutamate receptor 3.3 chr1:15973489-15976703 FORWARD LENGTH=933 | 1.0e-24 | 66% |
RefSeq | Arabidopsis thaliana | NP_174978.1 | glutamate receptor 3.3 [Arabidopsis thaliana] | 2.0e-24 | 66% |
RefSeq | Populus trichocarpa | XP_002306988.1 | glutamate-gated kainate-type ion channel receptor subunit GluR5, partial [Populus trichocarpa] | 6.0e-27 | 67% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9C8E7
Fln msg: Distance to subject end: 104 aas, your sequence is shorter than subject: 68 - 933
Fln protein:
I
Protein Length:
69
Fln nts:
A
Fln Alignment:
HIF1XHV03HH01K___IVGSEFTKGGWGFAFPKGSQLAIDFSTAILTLSETGELQRIHDKWLSQNNCGSQANQVDSTQLHLKSF
Q9C8E7________________IVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKSF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain