UniGene Name: sp_v3.0_unigene167954
Length: 220 nt
![]() |
---|
>sp_v3.0_unigene167954
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | receptor ser/thr protein kinase-like [Oryza sativa Japonica Group] dbj|BAD25902.1| receptor ser/thr protein kinase-like [Oryza sativa Japonica Group] | - | - | 7.0e-08 | 78% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
Sma3 | Chromosome undetermined scaffold_302, whole genome shotgun sequence | - | - | 6.089e-08 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 3.801e-20 | - |
Source | Gene names |
---|---|
Sma3 | At1g70520; At4g11490; At4g11530; At4g21230; At4g23140; At4g23160; At4g23230; At4g38830; At5g40380; CRK15; CRK2; CRK26; CRK27; CRK33; CRK35; CRK42; CRK6; CRK8; F21P8.120; F21P8.30; F21P8.50; F24J13.9; F25E4.110; F25E4.150; F7H19.330; F7J7.170; GSVIVT000011 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G70520.1 | CRK2 cysteine-rich RLK (RECEPTOR-like protein kinase) 2 chr1:26584888-26587334 REVERSE LENGTH=649 | 3.0e-11 | 78% |
RefSeq | Arabidopsis thaliana | NP_177209.1 | cysteine-rich receptor-like protein kinase 2 [Arabidopsis thaliana] | 4.0e-11 | 78% |
RefSeq | Populus trichocarpa | XP_002314608.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-11 | 71% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLL8
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 123 aas, your sequence is shorter than subject: 72 - 245
Fln protein:
I
Protein Length:
73
Fln nts:
A
Fln Alignment:
HIF1XHV03FZLMV___GYMAPEYLIHGHMTEKIDVYSFGVLVLEIISG
B8LLL8________________GYTAPEYAVHGQLTEKADVYSYGIVVLEIVSG
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain